SitesBLAST
Comparing 5210422 FitnessBrowser__PV4:5210422 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
42% identity, 98% coverage: 5:248/248 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (≠ F19), D36 (= D38), L37 (≠ I39), C61 (= C60), D62 (= D61), V63 (= V62), N89 (= N88), A90 (= A89), T140 (≠ V139), S142 (= S141), Y155 (= Y154), K159 (= K158), A186 (≠ F185), V187 (≠ F186)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 97% coverage: 5:244/248 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G18), S142 (= S141), I152 (≠ L151), Y155 (= Y154), K159 (= K158)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M210), R211 (= R211), R212 (= R212)
- binding bicarbonate ion: I92 (= I91), G94 (≠ A93), R109 (≠ L108), R179 (≠ Q178), S228 (≠ N228)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ S17), G16 (= G18), I17 (≠ F19), D36 (= D38), I37 (= I39), D62 (= D61), T63 (≠ V62), N89 (= N88), A90 (= A89), G91 (= G90), I140 (≠ V139), Y155 (= Y154), K159 (= K158), P185 (= P184), A186 (≠ F185), I188 (≠ T187), T190 (= T189)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 97% coverage: 5:244/248 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G18), S142 (= S141), I152 (≠ L151), Y155 (= Y154), K159 (= K158)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I91), S93 (= S92), G94 (≠ A93), E95 (≠ P94), T97 (≠ K96), E101 (≠ A100), T103 (= T102), Q106 (≠ D105), R109 (≠ L108), S175 (≠ A174), G177 (= G176)
- binding magnesium ion: S237 (≠ Q237), Y238 (≠ A238)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ S17), G16 (= G18), I17 (≠ F19), D36 (= D38), I37 (= I39), W41 (≠ A43), D62 (= D61), T63 (≠ V62), N89 (= N88), A90 (= A89), G91 (= G90), I140 (≠ V139), Y155 (= Y154), K159 (= K158), P185 (= P184), I188 (≠ T187), T190 (= T189)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 97% coverage: 5:244/248 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G18), S142 (= S141), I152 (≠ L151), Y155 (= Y154), K159 (= K158)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S17), G16 (= G18), I17 (≠ F19), N89 (= N88), G91 (= G90), Y155 (= Y154), P185 (= P184), A186 (≠ F185)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 98% coverage: 5:248/248 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G18), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (= S17), G16 (= G18), I17 (≠ F19), D36 (= D38), I37 (= I39), A61 (≠ C60), D62 (= D61), T63 (≠ V62), N89 (= N88), A90 (= A89), M140 (≠ V139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), A186 (≠ F185), Y187 (≠ F186), I188 (≠ T187), L192 (≠ M191)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
36% identity, 99% coverage: 3:247/248 of query aligns to 9:265/267 of Q9LBG2
- 17:42 (vs. 11:36, 62% identical) binding
- E103 (≠ S92) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
36% identity, 98% coverage: 5:247/248 of query aligns to 2:256/258 of 1iy8A
- active site: G15 (= G18), S143 (= S141), Q153 (≠ L151), Y156 (= Y154), K160 (= K158)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (= S17), G15 (= G18), L16 (≠ F19), D35 (= D38), V36 (≠ I39), A62 (≠ C60), D63 (= D61), V64 (= V62), N90 (= N88), G92 (= G90), I93 (= I91), T141 (≠ V139), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (≠ F185), T191 (= T189), P192 (= P190), M193 (= M191)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
36% identity, 96% coverage: 8:245/248 of query aligns to 3:253/256 of 1gegE
- active site: G13 (= G18), S139 (= S141), Y152 (= Y154), K156 (= K158), V197 (≠ L200)
- binding alpha-D-glucopyranose: R63 (≠ E65), D64 (≠ A66), F67 (≠ L69), E123 (≠ P126)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), Q12 (≠ S17), I14 (≠ F19), D33 (= D38), Y34 (≠ I39), V58 (≠ C60), D59 (= D61), V60 (= V62), N86 (= N88), A87 (= A89), I109 (= I112), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), V185 (≠ T187), T187 (= T189), M189 (= M191)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
35% identity, 96% coverage: 8:245/248 of query aligns to 3:253/256 of Q48436
- 6:33 (vs. 11:38, 43% identical) binding
- D59 (= D61) binding
- K156 (= K158) binding
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 98% coverage: 3:245/248 of query aligns to 3:242/244 of 4nbuB
- active site: G18 (= G18), N111 (= N113), S139 (= S141), Q149 (≠ L151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (≠ P94), K98 (≠ T101), S139 (= S141), N146 (≠ A148), V147 (≠ P149), Q149 (≠ L151), Y152 (= Y154), F184 (= F186), M189 (= M191), K200 (≠ Q203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ S17), G18 (= G18), I19 (≠ F19), D38 (= D38), F39 (≠ I39), V59 (≠ C60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (= I91), T137 (≠ V139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (= F186), T185 (= T187), T187 (= T189), M189 (= M191)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 98% coverage: 5:246/248 of query aligns to 3:244/248 of Q9KJF1
- S15 (= S17) binding
- D36 (= D38) binding
- D62 (= D61) binding
- I63 (≠ V62) binding
- N89 (= N88) binding
- Y153 (= Y154) binding
- K157 (= K158) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
37% identity, 98% coverage: 5:246/248 of query aligns to 2:243/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (≠ F19), D35 (= D38), I36 (= I39), I62 (≠ V62), N88 (= N88), G90 (= G90), I138 (≠ V139), S140 (= S141), Y152 (= Y154), K156 (= K158), I185 (≠ T187)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 100% coverage: 1:247/248 of query aligns to 1:260/261 of 6zzsD
- active site: G18 (= G18), S143 (= S141), Y156 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (= S17), I19 (≠ F19), D38 (= D38), M39 (≠ I39), D64 (= D61), V65 (= V62), N91 (= N88), A92 (= A89), G93 (= G90), M141 (≠ V139), A142 (= A140), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (≠ F185), V189 (≠ T187), T191 (= T189), L193 (≠ M191)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ S92), S143 (= S141), N145 (≠ A143), K153 (≠ L151), Y156 (= Y154), Q197 (vs. gap)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
36% identity, 98% coverage: 5:247/248 of query aligns to 4:259/260 of 6zzqA
- active site: G17 (= G18), S142 (= S141), Y155 (= Y154)
- binding acetoacetic acid: Q94 (≠ S92), S142 (= S141), K152 (≠ L151), Y155 (= Y154), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), S16 (= S17), G17 (= G18), I18 (≠ F19), D37 (= D38), M38 (≠ I39), D63 (= D61), V64 (= V62), N90 (= N88), A91 (= A89), G92 (= G90), M140 (≠ V139), A141 (= A140), S142 (= S141), Y155 (= Y154), K159 (= K158), Y187 (≠ F186), V188 (≠ T187), T190 (= T189)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
35% identity, 96% coverage: 8:245/248 of query aligns to 6:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), Q15 (≠ S17), G16 (= G18), I17 (≠ F19), D36 (= D38), V63 (= V62), N89 (= N88), A91 (≠ G90), S94 (vs. gap), I142 (≠ V139), S143 (≠ A140), S144 (= S141), Y157 (= Y154), K161 (= K158), P187 (= P184), H188 (vs. gap), I190 (≠ F185), I194 (≠ T189)
4qecA Elxo with NADP bound (see paper)
33% identity, 96% coverage: 8:244/248 of query aligns to 3:244/248 of 4qecA
- active site: G13 (= G18), N111 (= N113), S139 (= S141), Y152 (= Y154), K156 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ S17), G13 (= G18), I14 (≠ F19), S33 (≠ D38), R34 (≠ I39), K38 (≠ N40), D59 (= D61), V60 (= V62), N86 (= N88), A87 (= A89), G88 (= G90), I137 (≠ V139), Y152 (= Y154), K156 (= K158), P182 (= P184), I185 (≠ T187)
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
36% identity, 98% coverage: 3:246/248 of query aligns to 1:242/253 of 2hsdA
- active site: G16 (= G18), S138 (= S141), Y151 (= Y154), K155 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (≠ S17), G16 (= G18), L17 (≠ F19), D36 (= D38), V37 (≠ I39), L58 (≠ C60), V60 (= V62), N86 (= N88), A87 (= A89), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (≠ F185), T184 (= T187)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
36% identity, 98% coverage: 3:246/248 of query aligns to 1:242/253 of 1hdcA
- active site: G16 (= G18), S138 (= S141), Y151 (= Y154), K155 (= K158)
- binding carbenoxolone: S90 (= S92), T91 (≠ A93), G92 (≠ P94), L147 (≠ K150), Y151 (= Y154), M183 (≠ F186), M188 (= M191), T189 (≠ V192), T192 (vs. gap)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
34% identity, 100% coverage: 1:247/248 of query aligns to 1:245/252 of 6vspB
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 100% coverage: 1:247/248 of query aligns to 4:252/258 of 4wecA
- active site: G21 (= G18), S143 (= S141), Q154 (≠ L151), Y157 (= Y154), K161 (= K158)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (= S17), G21 (= G18), I22 (≠ F19), D41 (= D38), I42 (= I39), V61 (= V62), D62 (≠ S63), V63 (≠ I64), N89 (= N88), T141 (≠ V139), Y157 (= Y154), K161 (= K158), P187 (= P184), P189 (≠ F186), V190 (≠ T187)
Query Sequence
>5210422 FitnessBrowser__PV4:5210422
MQSNFEGKVVLITGAASGFGKLLAQRLAPQGAKLVLGDINDTALDALCSELGECAVGLRC
DVSIEAEQLALAQLAEESFGRLDIAINNAGISAPMKSLLATTEADMDLSFAINTKGVFFG
MKAQIPLMQKHKCGAILNVASMAGINGAPKLTPYVAAKHAVVGITRTAALEFAAQGIQVN
AICPFFTPTPMVTEGVDPALIEQLTRAVPMRRLADPNEVVSAMLHMVNPDNGFMTGQAIA
IDGGVSAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory