SitesBLAST
Comparing 5210423 Shew_2864 3-hydroxyacyl-CoA dehydrogenase, NAD-binding (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
49% identity, 98% coverage: 7:703/708 of query aligns to 4:690/692 of 6iunB
- active site: A60 (= A63), F65 (= F68), E73 (= E76), H77 (≠ P80), G101 (= G104), E104 (= E107), E124 (= E127), G132 (= G135), K248 (= K255), S407 (= S415), H428 (= H436), E440 (= E448), N478 (= N486)
- binding nicotinamide-adenine-dinucleotide: G300 (= G308), T301 (= T309), M302 (= M310), E321 (≠ D329), T322 (≠ L330), Y365 (= Y373), A377 (= A385), V378 (= V386), E380 (= E388), V384 (≠ I392), V388 (= V396), N405 (= N413), S407 (= S415)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
40% identity, 98% coverage: 4:700/708 of query aligns to 2:705/723 of Q08426
- E3 (≠ T5) to K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- V40 (≠ E42) to G: in dbSNP:rs1062551
- I41 (≠ A43) to R: in dbSNP:rs1062552
- T75 (≠ N78) to I: in dbSNP:rs1062553
- K165 (≠ D168) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ N174) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A279) to T: in dbSNP:rs2302819
- A325 (≠ I327) to G: in dbSNP:rs1062555
- K346 (≠ Y348) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (vs. gap) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ E589) to T: in dbSNP:rs1042437
- T606 (≠ E597) to P: in dbSNP:rs1042438
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
40% identity, 97% coverage: 14:700/708 of query aligns to 17:707/723 of 6zibAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), G136 (= G135), K254 (= K255), S413 (= S415), H434 (= H436), E446 (= E448), N484 (= N486)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (≠ G61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G103), G105 (= G104), E128 (= E127), Y161 (≠ P160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G308), T311 (= T309), M312 (= M310), E331 (≠ D329), S332 (≠ L330), Q336 (≠ A334), A383 (= A385), V384 (= V386), F385 (= F387), E386 (= E388), N411 (= N413), H434 (= H436)
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
40% identity, 97% coverage: 14:700/708 of query aligns to 17:707/723 of 6zicAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), G136 (= G135), K254 (= K255), S413 (= S415), H434 (= H436), E446 (= E448), N484 (= N486)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P22), V26 (= V23), A28 (≠ S25), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G103), G105 (= G104), E108 (= E107), E128 (= E127), Y161 (≠ P160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G306), G310 (= G308), T311 (= T309), M312 (= M310), E331 (≠ D329), S332 (≠ L330), Q336 (≠ A334), A383 (= A385), V384 (= V386), F385 (= F387), E386 (= E388), L390 (≠ I392), K391 (= K393), N411 (= N413), S413 (= S415), H434 (= H436)
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
40% identity, 97% coverage: 14:700/708 of query aligns to 15:707/723 of 3zw9A
- active site: A64 (= A63), F69 (= F68), G79 (≠ P80), G103 (= G104), E106 (= E107), P125 (= P126), E126 (= E127), P133 (= P134), G134 (= G135), K252 (= K255), S413 (= S415), H434 (= H436), E446 (= E448), N484 (= N486)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I305), G306 (= G306), G308 (= G308), T309 (= T309), M310 (= M310), E329 (≠ D329), Q334 (≠ A334), A383 (= A385), V384 (= V386), F385 (= F387), E386 (= E388), N411 (= N413), S413 (= S415), H434 (= H436)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V23), A62 (≠ G61), G63 (= G62), A64 (= A63), I66 (= I65), G102 (= G103), G103 (= G104), E106 (= E107), E126 (= E127), P133 (= P134), Y159 (≠ P160)
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
40% identity, 97% coverage: 14:700/708 of query aligns to 18:710/727 of 3zwaA
- active site: A67 (= A63), F72 (= F68), G82 (≠ P80), G106 (= G104), E109 (= E107), P128 (= P126), E129 (= E127), P136 (= P134), G137 (= G135), K255 (= K255), S416 (= S415), H437 (= H436), E449 (= E448), N487 (= N486)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V23), A65 (≠ G61), G66 (= G62), A67 (= A63), D68 (= D64), I69 (= I65), L104 (= L102), E109 (= E107), R124 (≠ K122), E129 (= E127), L132 (= L130), G137 (= G135), Y162 (≠ P160)
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
40% identity, 97% coverage: 14:700/708 of query aligns to 17:709/725 of 5omoA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), P135 (= P134), G136 (= G135), K254 (= K255), S415 (= S415), H436 (= H436), E448 (= E448), N486 (= N486)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P22), V26 (= V23), A28 (≠ S25), P31 (≠ L28), A64 (≠ G61), A66 (= A63), D67 (= D64), I68 (= I65), L103 (= L102), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), Y161 (≠ P160), F260 (= F261), K280 (≠ R281)
- binding 3-keto-decanoyl-coa: S415 (= S415), N486 (= N486), K519 (≠ P519), M520 (= M520), V525 (≠ M525), Y658 (≠ F648)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
40% identity, 97% coverage: 14:700/708 of query aligns to 17:709/725 of 5mgbA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), P135 (= P134), G136 (= G135), K254 (= K255), S415 (= S415), H436 (= H436), E448 (= E448), N486 (= N486)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (≠ G61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G105 (= G104), E128 (= E127), Y161 (≠ P160)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I305), G308 (= G306), G310 (= G308), T311 (= T309), M312 (= M310), E331 (≠ D329), S332 (≠ L330), Q336 (≠ A334), V386 (= V386), F387 (= F387), E388 (= E388), N413 (= N413), S415 (= S415), H436 (= H436)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
40% identity, 97% coverage: 14:700/708 of query aligns to 17:709/725 of 3zwcA
- active site: A66 (= A63), F71 (= F68), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), P135 (= P134), G136 (= G135), K254 (= K255), S415 (= S415), H436 (= H436), E448 (= E448), N486 (= N486)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V23), A64 (≠ G61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G77 (≠ A73), L78 (= L74), L80 (= L79), V101 (≠ L100), G104 (= G103), G105 (= G104), E108 (= E107), E128 (= E127), F260 (= F261)
- binding nicotinamide-adenine-dinucleotide: G308 (= G306), G310 (= G308), T311 (= T309), M312 (= M310), E331 (≠ D329), Q336 (≠ A334), A385 (= A385), V386 (= V386), F387 (= F387), E388 (= E388), K393 (= K393), N413 (= N413), S415 (= S415), H436 (= H436)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
40% identity, 97% coverage: 14:700/708 of query aligns to 17:709/725 of 2x58A
- active site: A66 (= A63), F71 (= F68), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), E128 (= E127), P135 (= P134), G136 (= G135), K254 (= K255), S415 (= S415), H436 (= H436), E448 (= E448), N486 (= N486)
- binding adenosine-5'-diphosphate: G310 (= G308), T311 (= T309), M312 (= M310), E331 (≠ D329), S332 (≠ L330), Q336 (≠ A334), V386 (= V386), L392 (≠ I392)
- binding coenzyme a: V26 (= V23), A28 (≠ S25), A64 (≠ G61), A66 (= A63), D67 (= D64), I68 (= I65), E128 (= E127)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
40% identity, 97% coverage: 14:700/708 of query aligns to 18:703/716 of 6z5oAAA
- active site: A67 (= A63), F72 (= F68), G82 (≠ P80), G106 (= G104), E109 (= E107), P128 (= P126), E129 (= E127), G137 (= G135), K255 (= K255), S409 (= S415), H430 (= H436), E442 (= E448), N480 (= N486)
- binding coenzyme a: P26 (= P22), V27 (= V23), A65 (≠ G61), D68 (= D64), I69 (= I65), P128 (= P126), Y162 (≠ P160), F277 (= F277), K281 (≠ R281)
- binding nicotinamide-adenine-dinucleotide: G309 (= G306), G311 (= G308), T312 (= T309), M313 (= M310), E332 (≠ D329), S333 (≠ L330), Q337 (≠ A334), A379 (= A385), V380 (= V386), F381 (= F387), E382 (= E388), K387 (= K393), N407 (= N413), S409 (= S415), H430 (= H436)
- binding nicotinamide: A67 (= A63), E109 (= E107), E129 (= E127), P136 (= P134), F261 (= F261)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
39% identity, 97% coverage: 14:700/708 of query aligns to 17:709/725 of 3zwbA
- active site: A66 (= A63), G81 (≠ P80), G105 (= G104), E108 (= E107), P127 (= P126), A128 (≠ E127), P135 (= P134), G136 (= G135), S415 (= S415), H436 (= H436), E448 (= E448), N486 (= N486)
- binding (2E)-Hexenoyl-CoA: P25 (= P22), V26 (= V23), A28 (≠ S25), A64 (≠ G61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), V101 (≠ L100), L103 (= L102), G105 (= G104), E108 (= E107), G136 (= G135), Y161 (≠ P160), K280 (≠ R281)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
32% identity, 97% coverage: 7:693/708 of query aligns to 43:750/763 of P40939
- V282 (≠ I217) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I239) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L276) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E448) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
32% identity, 94% coverage: 42:703/708 of query aligns to 48:713/715 of 1wdlA
- active site: A69 (= A63), N89 (≠ A85), N93 (≠ S89), G117 (= G104), E120 (= E107), P139 (= P126), E140 (= E127), P147 (= P134), G148 (= G135), S430 (= S415), H451 (= H436), E463 (= E448), N501 (= N486)
- binding nicotinamide-adenine-dinucleotide: A322 (≠ S307), I324 (≠ T309), M325 (= M310), D344 (= D329), I345 (≠ L330), A400 (= A385), V401 (= V386), E403 (= E388), N428 (= N413), T429 (= T414), S430 (= S415)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
32% identity, 94% coverage: 42:703/708 of query aligns to 48:713/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
33% identity, 94% coverage: 42:703/708 of query aligns to 48:705/707 of 1wdmA
- active site: A69 (= A63), N89 (≠ A85), N93 (≠ S89), G117 (= G104), E120 (= E107), P139 (= P126), E140 (= E127), P147 (= P134), G148 (= G135), S430 (= S415), H451 (= H436), E463 (= E448), N501 (= N486)
- binding acetyl coenzyme *a: K142 (≠ N129), D297 (≠ E280), M459 (= M444), N501 (= N486), P534 (= P519), Y652 (= Y646), L658 (≠ I652)
- binding nicotinamide-adenine-dinucleotide: G321 (= G306), A322 (≠ S307), I324 (≠ T309), M325 (= M310), D344 (= D329), V401 (= V386), E403 (= E388), N428 (= N413), S430 (= S415), N454 (≠ S439)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 95% coverage: 5:677/708 of query aligns to 7:691/729 of P21177
- G116 (= G104) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G308) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H436) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
32% identity, 98% coverage: 14:708/708 of query aligns to 14:707/707 of 6yswA
- active site: A66 (= A63), I71 (≠ F68), A84 (= A75), Q88 (≠ P80), G112 (= G104), E115 (= E107), P136 (= P126), E137 (= E127), G145 (= G135), D264 (≠ K255), S422 (= S415), H443 (= H436), E455 (= E448), N493 (= N486)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V23), A66 (= A63), D67 (= D64), I68 (= I65), P136 (= P126), E137 (= E127), L140 (= L130), T290 (≠ R281), K293 (≠ A284)
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
33% identity, 95% coverage: 5:677/708 of query aligns to 7:691/719 of 6tnmA
- active site: A68 (= A63), F73 (= F68), G116 (= G104), E119 (= E107), P138 (= P126), E139 (= E127), G147 (= G135), N271 (≠ K255), S429 (= S415), H450 (= H436), E462 (= E448), N500 (= N486)
- binding adenosine-5'-triphosphate: D343 (= D329), I344 (≠ L330), V400 (= V386), V401 (≠ F387), V406 (≠ I392), K584 (= K568)
3k6jA Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.Elegans
35% identity, 53% coverage: 298:673/708 of query aligns to 45:407/430 of 3k6jA
Sites not aligning to the query:
Query Sequence
>5210423 Shew_2864 3-hydroxyacyl-CoA dehydrogenase, NAD-binding (RefSeq)
MTNATLYQIHGRTAVIILNQPPVNSLGLALRTHLLADLKRAEADESVDAIVLASSGKLFC
GGADISEFSSDDALAEPNLPQVCDALEASPKLVVAAVNGLALGGGCELTLACDYRIALPA
AKLGLPEVNLGILPGAGGTQRLPRIGGVQLALEMITSGRPLGAAAMLDAGVIDNLYQDGG
NFIQAAVDFAQELVAQHKPKRSCFEMSVDTSNISSEIFNEFRAAIARRSRGYYAPERCIQ
AVEAACELPLAEGLKREHQLFMECLDTPQARAQQHLFFAERGVAKIPGINPKTTATREIR
KVAVIGSGTMGGGIAMNFINVGIPTQILDLNGEALERGLGVIRKNYEYTLKKGKLSQAQL
DERMALLSGTTDYADIADVDLVIEAVFEKMEIKKQVFKTLDATCKPGAILATNTSTLDVD
EIAAETSRPQDVLGLHFFSPANVMRLLEIVRANKTAPDALLTTVQLAQRIKKVPVVSGVC
WGFIGNRATDSYLRESMSLILEGASPAQIDKVHTEFGMPMGLPSMVDLAGIDVGILTRED
RKAFTTDLDPSHFAILHKLYAKQRYGQKTGRGLYIYEGRDKQEDPEVLELAAEAAKEFGV
TRRSPEQISDQEILERTIYPIINEGARILEEGIALRASDIDIVLAYGFGFPIFRGGPMQY
ADEIGLERVLTALNKYRDTLDKGELWFKPAPLLERLVKEGKTFAQYQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory