SitesBLAST
Comparing 5210455 FitnessBrowser__PV4:5210455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xpgA X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to beta-cft or win35428 (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:499/533 of 4xpgA
- binding methyl (1R,2S,3S,5S)-3-(4-fluorophenyl)-8-methyl-8-azabicyclo[3.2.1]octane-2-carboxylate: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), F252 (= F234), F258 (= F240), G358 (≠ I340)
- binding chloride ion: Y45 (= Y45), S253 (≠ T235), S289 (= S271)
- binding cholesterol: Y206 (vs. gap), L210 (= L192), I284 (= I266)
- binding sodium ion: G18 (= G18), F19 (≠ S19), A20 (= A20), V21 (≠ I21), D22 (≠ G22), N25 (= N25), S253 (≠ T235), N285 (= N267), L350 (≠ A332), G351 (= G333), D353 (≠ S335), S354 (= S336)
6m3zA X-ray structure of a drosophila dopamine transporter with net-like mutations (d121g/s426m/f471l) in milnacipran bound form (see paper)
31% identity, 95% coverage: 2:477/503 of query aligns to 2:501/536 of 6m3zA
- binding cholesterol: L212 (= L192), I286 (= I266)
- binding (1R,2S)-2-(aminomethyl)-N,N-diethyl-1-phenyl-cyclopropane-1-carboxamide: F19 (≠ S19), V96 (≠ I100), Y99 (= Y103), Y100 (= Y104), F254 (= F234), F260 (= F240), S356 (= S336), G360 (≠ I340)
- binding alpha-D-glucopyranose: Y277 (≠ N257), F448 (= F425)
6m0zA X-ray structure of drosophila dopamine transporter with net-like mutations (d121g/s426m/f471l) in l-norepinephrine bound form (see paper)
31% identity, 95% coverage: 2:477/503 of query aligns to 2:501/536 of 6m0zA
6m47A X-ray structure of a drosophila dopamine transporter with net-like mutations (d121g/s426m/f471l) in tramadol bound form (see paper)
31% identity, 95% coverage: 2:477/503 of query aligns to 2:501/534 of 6m47A
4xpfA X-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to rti-55 (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:499/532 of 4xpfA
- binding methyl (1R,2S,3S,5S)-3-(4-iodophenyl)-8-methyl-8-azabicyclo[3.2.1]octane-2-carboxylate: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), G97 (≠ A101), Y100 (= Y104), F258 (= F240)
- binding chloride ion: Y45 (= Y45), S253 (≠ T235), S289 (= S271)
- binding cholesterol: Y206 (vs. gap), L210 (= L192), I284 (= I266)
- binding decyl-beta-d-maltopyranoside: R109 (≠ S113), F112 (≠ G116), Y152 (≠ H134), D171 (≠ G152)
- binding sodium ion: G18 (= G18), F19 (≠ S19), A20 (= A20), V21 (≠ I21), D22 (≠ G22), N25 (= N25), S253 (≠ T235), N285 (= N267), L350 (≠ A332), G351 (= G333), D353 (≠ S335), S354 (= S336)
7wlwA X-ray structure of thermostabilized drosophila dopamine transporter with gaba transporter1-like substitutions in the binding site, in complex with skf89976a (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/536 of 7wlwA
- binding (3S)-1-(4,4-diphenylbut-3-enyl)piperidine-3-carboxylic acid: Y19 (≠ S19), G22 (= G22), L23 (= L23), A24 (≠ G24), L96 (≠ I100), Y99 (= Y103), Y100 (= Y104), T250 (≠ G230), F253 (= F233), F254 (= F234), F254 (= F234), G257 (≠ S237), P258 (≠ V238), L260 (≠ F240), P321 (≠ I301), D410 (= D387), A414 (≠ N391)
- binding cholesterol: I17 (≠ V17), Y208 (vs. gap), L212 (= L192)
- binding decyl-beta-d-maltopyranoside: R109 (≠ S113), F112 (≠ G116), Y154 (≠ H134), L176 (≠ I155)
- binding cholesterol hemisuccinate: L49 (≠ M49), G451 (= G428), Y453 (≠ W430)
7wgtA X-ray structure of thermostabilized drosophila dopamine transporter with gaba transporter1-like substitutions in the binding site, in complex with no711. (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/536 of 7wgtA
- binding 1-(2-{[(diphenylmethylidene)amino]oxy}ethyl)-1,2,5,6-tetrahydropyridine-3-carboxylic acid: Y19 (≠ S19), G22 (= G22), A24 (≠ G24), L96 (≠ I100), F253 (= F233), F254 (= F234), G257 (≠ S237), P258 (≠ V238), A414 (≠ N391), I418 (≠ L395)
- binding cholesterol: Y208 (vs. gap), L212 (= L192)
- binding cholesterol hemisuccinate: Y277 (≠ N257), S288 (≠ C268), A289 (≠ G269), G451 (= G428), W454 (≠ F431)
4xnuA X-ray structure of drosophila dopamine transporter in complex with nisoxetine (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:499/532 of 4xnuA
4m48A X-ray structure of dopamine transporter elucidates antidepressant mechanism (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:499/532 of 4m48A
- binding Nortriptyline: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), Y100 (= Y104), F258 (= F240), S354 (= S336), G358 (≠ I340)
- binding cholesterol: Y206 (vs. gap), L210 (= L192), I284 (= I266), I291 (≠ L273)
- binding sodium ion: G18 (= G18), F19 (≠ S19), A20 (= A20), V21 (≠ I21), V21 (≠ I21), D22 (≠ G22), D22 (≠ G22), N25 (= N25), S253 (≠ T235), N285 (= N267), L350 (≠ A332), D353 (≠ S335), S354 (= S336)
6m38A X-ray structure of a drosophila dopamine transporter with subsiteb mutations (d121g/s426m) in s-duloxetine bound form (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/534 of 6m38A
- binding (3S)-N-methyl-3-(naphthalen-1-yloxy)-3-(thiophen-2-yl)propan-1-amine: F19 (≠ S19), A20 (= A20), D22 (≠ G22), A93 (= A97), V96 (≠ I100), Y100 (= Y104), F254 (= F234), S255 (≠ T235), F260 (= F240), G360 (≠ I340)
- binding cholesterol: Y208 (vs. gap), L212 (= L192), I286 (= I266)
- binding decyl-beta-d-maltopyranoside: R109 (≠ S113), F112 (≠ G116), A113 (≠ F117), D173 (≠ G152), L176 (≠ I155)
Q9NSD5 Sodium- and chloride-dependent GABA transporter 2; GAT-2; Solute carrier family 6 member 13 from Homo sapiens (Human) (see paper)
29% identity, 88% coverage: 1:442/503 of query aligns to 30:503/602 of Q9NSD5
- E48 (≠ S19) mutation to A: 50% reduction of GABA-uptake.; mutation E->L,Y: 90% reduction of GABA-uptake.
- G51 (= G22) mutation G->A,L: Complete loss of GABA-uptake.
- V132 (≠ I107) mutation to I: Complete loss of GABA-uptake.
4xpaA X-ray structure of drosophila dopamine transporter bound to 3, 4dichlorophenethylamine (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/534 of 4xpaA
- binding 2-(3,4-dichlorophenyl)ethanamine: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), F254 (= F234), F260 (= F240), S356 (= S336)
- binding beta-D-glucopyranose: R109 (≠ S113), A113 (≠ F117)
- binding chloride ion: S255 (≠ T235), S291 (= S271)
- binding cholesterol: A50 (≠ I50), Y208 (vs. gap), I286 (= I266), F292 (≠ I272), Y453 (≠ W430), W454 (≠ F431)
- binding sodium ion: G18 (= G18), F19 (≠ S19), A20 (= A20), V21 (≠ I21), V21 (≠ I21), D22 (≠ G22), N25 (= N25), S255 (≠ T235), N287 (= N267), L352 (≠ A332), G353 (= G333), D355 (≠ S335), S356 (= S336)
4xp6A X-ray structure of drosophila dopamine transporter bound to psychostimulant methamphetamine (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/534 of 4xp6A
- binding (2S)-N-methyl-1-phenylpropan-2-amine: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), F260 (= F240), S356 (= S336)
- binding chloride ion: S255 (≠ T235), S291 (= S271)
- binding cholesterol: L13 (≠ I13), L205 (= L187), Y208 (vs. gap), L212 (= L192), I286 (= I266)
- binding alpha-D-glucopyranose: R109 (≠ S113), A113 (≠ F117)
- binding sodium ion: G18 (= G18), A20 (= A20), V21 (≠ I21), N25 (= N25), S255 (≠ T235), N287 (= N267), L352 (≠ A332), G353 (= G333), D355 (≠ S335), S356 (= S336)
- binding cholesterol hemisuccinate: I54 (= I54), Y453 (≠ W430), W454 (≠ F431)
4xp5A X-ray structure of drosophila dopamine transporter bound to cocaine analogue-rti55 (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/534 of 4xp5A
- binding methyl (1R,2S,3S,5S)-3-(4-iodophenyl)-8-methyl-8-azabicyclo[3.2.1]octane-2-carboxylate: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), D97 (≠ A101), Y100 (= Y104), F254 (= F234), S255 (≠ T235), F260 (= F240), G360 (≠ I340)
- binding chloride ion: S255 (≠ T235), S291 (= S271)
- binding cholesterol: L13 (≠ I13), L14 (= L14), L49 (≠ M49), A50 (≠ I50), Y208 (vs. gap), I286 (= I266), Y453 (≠ W430), W454 (≠ F431)
- binding alpha-D-glucopyranose: R109 (≠ S113), F112 (≠ G116), A113 (≠ F117), Y154 (≠ H134)
- binding sodium ion: G18 (= G18), A20 (= A20), V21 (≠ I21), D22 (≠ G22), N25 (= N25), S255 (≠ T235), N287 (= N267), L352 (≠ A332), D355 (≠ S335), S356 (= S336)
4xp4A X-ray structure of drosophila dopamine transporter in complex with cocaine (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/534 of 4xp4A
- binding chloride ion: S255 (≠ T235), S291 (= S271)
- binding cocaine: F19 (≠ S19), D22 (≠ G22), V96 (≠ I100), D97 (≠ A101), Y100 (= Y104), F254 (= F234), S255 (≠ T235), F260 (= F240), S356 (= S336), G360 (≠ I340)
- binding sodium ion: G18 (= G18), F19 (≠ S19), A20 (= A20), V21 (≠ I21), D22 (≠ G22), N25 (= N25), S255 (≠ T235), N287 (= N267), L352 (≠ A332), G353 (= G333), D355 (≠ S335), S356 (= S336)
- binding cholesterol hemisuccinate: L49 (≠ M49), I54 (= I54), Y453 (≠ W430), W454 (≠ F431)
4xnxA X-ray structure of drosophila dopamine transporter in complex with reboxetine (see paper)
31% identity, 95% coverage: 2:477/503 of query aligns to 2:501/536 of 4xnxA
- binding (2R)-2-[(R)-(2-ethoxyphenoxy)(phenyl)methyl]morpholine: F19 (≠ S19), A20 (= A20), D22 (≠ G22), A93 (= A97), V96 (≠ I100), D97 (≠ A101), Y100 (= Y104), S255 (≠ T235), G360 (≠ I340)
- binding cholesterol: Y208 (vs. gap), L212 (= L192), I286 (= I266), Y453 (≠ W430), W454 (≠ F431)
- binding alpha-D-glucopyranose: R109 (≠ S113), Y154 (= Y135)
4xp1A X-ray structure of drosophila dopamine transporter bound to neurotransmitter dopamine (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/535 of 4xp1A
- binding chloride ion: S255 (≠ T235), S291 (= S271)
- binding cholesterol: L13 (≠ I13), Y208 (vs. gap), L212 (= L192), I286 (= I266)
- binding alpha-D-glucopyranose: R109 (≠ S113), Y154 (≠ H134)
- binding l-dopamine: V96 (≠ I100), D97 (≠ A101), Y100 (= Y104), F260 (= F240), G360 (≠ I340)
- binding sodium ion: G18 (= G18), F19 (≠ S19), A20 (= A20), V21 (≠ I21), N25 (= N25), S255 (≠ T235), N287 (= N267), L352 (≠ A332), G353 (= G333), D355 (≠ S335), S356 (= S336)
- binding cholesterol hemisuccinate: F285 (≠ L265), F292 (≠ I272), G451 (= G428)
4xp9C X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine (see paper)
30% identity, 95% coverage: 2:477/503 of query aligns to 2:501/537 of 4xp9C
- binding (2S)-1-phenylpropan-2-amine: F19 (≠ S19), D22 (≠ G22), S255 (≠ T235), F260 (= F240)
- binding chloride ion: S255 (≠ T235), S291 (= S271)
- binding sodium ion: G18 (= G18), A20 (= A20), V21 (≠ I21), V21 (≠ I21), D22 (≠ G22), N25 (= N25), S255 (≠ T235), N287 (= N267), L352 (≠ A332), G353 (= G333), D355 (≠ S335), S356 (= S336)
- binding cholesterol hemisuccinate: G451 (= G428), W454 (≠ F431)
7txtS Structure of human serotonin transporter bound to small molecule '8090 in lipid nanodisc and nacl
32% identity, 89% coverage: 2:451/503 of query aligns to 2:481/541 of 7txtS
7lwdA Cryo-em structure of the wild-type human serotonin transporter complexed with vilazodone, imipramine and 15b8 fab (see paper)
32% identity, 89% coverage: 2:451/503 of query aligns to 2:481/541 of 7lwdA
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: Y19 (≠ S19), D22 (≠ G22), I96 (= I100), F265 (= F240), S362 (= S336), G366 (≠ I340)
- binding 5-{4-[4-(5-cyano-1H-indol-3-yl)butyl]piperazin-1-yl}-1-benzofuran-2-carboxamide: G24 (= G24), R28 (= R28), F259 (= F234), E418 (≠ Y388), T421 (≠ N391), P423 (≠ I393), F480 (≠ N450)
Sites not aligning to the query:
Query Sequence
>5210455 FitnessBrowser__PV4:5210455
MKREQWNSRVGFILAAVGSAIGLGNIWRFPYMAYDNGGGAFFIPYLFAMITAGIPFMIME
FSLGHKIKKTSPRIFAQLGHTLGFRLEWLGWFQVFIAAVIAVYYVAIIGWTLSYLGFSFS
QAWGDNPNDFFFNHYLKLGNNSPSHLGEFQIGIAIAMSIAWLMTFMAVFTGVKGGIERAN
KIMMPMLFIMVLVLIGRIMFLPGALSGLNYLFEPDFSRLLDAQVWSAAYGQIFFTLSVGF
AIMLAYSSYLPTKADINNNAFMTVLINCGFSILAGILIFGVLGYMAEEQMKPLTEVVSSG
IGLAFVTIPTAINLMPAPYILGPLFFIALVIAGLSSHISIIEAVTSAVIDKFHVRRKPAA
VLVCSLGYLVSMAFATNGGLLLLDLVDYFINNIALLLSCLLELVIITWLLKVTVIHQHAN
ENSEFRVGGWFVVCLRFISPAILATILAKNLYNTLVNGYGDYPIADQLFLGWGLVGTMLF
FAVLINFTSKSPGYPDQHPGGKT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory