SitesBLAST
Comparing 5210527 FitnessBrowser__PV4:5210527 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 80% coverage: 60:311/314 of query aligns to 68:319/325 of Q9FLY0
- G89 (≠ S83) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G132) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (= S196) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
34% identity, 95% coverage: 15:312/314 of query aligns to 19:313/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (= S80), T111 (= T109), G136 (= G134), V137 (≠ R135), Q138 (≠ L136), D159 (≠ G157), I160 (≠ R158), A199 (= A198), T200 (= T199), T201 (≠ G200), A202 (= A201), V206 (≠ L205), V221 (= V220), G222 (= G221), W223 (≠ N222), S296 (= S295), V297 (= V296), G298 (= G297)
- binding proline: R39 (= R35), M54 (≠ L52), K67 (= K63), R110 (= R108)
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
30% identity, 96% coverage: 12:311/314 of query aligns to 20:307/312 of 2i99A
- active site: G59 (≠ A50), S228 (≠ H223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (≠ G70), S90 (= S80), H91 (≠ L81), R118 (= R108), T119 (= T109), G142 (= G132), A143 (≠ T133), G144 (= G134), V145 (≠ R135), Q146 (≠ L136), N167 (≠ G157), R168 (= R158), T169 (≠ S159), V203 (≠ A198), T204 (= T199), L205 (≠ G200), A206 (= A201), V225 (= V220), G226 (= G221), S291 (= S295), L292 (≠ V296), G293 (= G297)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
30% identity, 96% coverage: 12:311/314 of query aligns to 21:308/314 of Q14894
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
30% identity, 96% coverage: 12:311/314 of query aligns to 19:299/303 of 4bv9A
- active site: G58 (≠ A50), S220 (≠ H223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (= S80), H83 (≠ L81), T111 (= T109), G134 (= G132), G136 (= G134), V137 (≠ R135), Q138 (≠ L136), N159 (≠ G157), R160 (= R158), T161 (≠ S159), V195 (≠ A198), T196 (= T199), M197 (≠ G200), A198 (= A201), V217 (= V220), G218 (= G221), S283 (= S295), L284 (≠ V296), G285 (= G297)
- binding pyruvic acid: R45 (= R35), M60 (≠ L52), K73 (= K63), R110 (= R108)
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
30% identity, 96% coverage: 12:311/314 of query aligns to 20:298/303 of 4bvaA
- active site: G59 (≠ A50), S219 (≠ H223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T105), R109 (= R108), T110 (= T109), G135 (= G134), V136 (≠ R135), Q137 (≠ L136), N158 (≠ G157), R159 (= R158), T160 (≠ S159), N163 (≠ K162), V194 (≠ A198), T195 (= T199), M196 (≠ G200), A197 (= A201), V216 (= V220), S282 (= S295), L283 (≠ V296), G284 (= G297)
- binding 3,5,3'triiodothyronine: R46 (= R35), F57 (≠ A48), G59 (≠ A50), V76 (≠ F65), F78 (≠ Y67), S219 (≠ H223), R220 (≠ N224), W223 (≠ R227), E247 (= E251)
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
27% identity, 83% coverage: 52:312/314 of query aligns to 54:307/320 of 1omoA
- active site: D219 (≠ H223)
- binding nicotinamide-adenine-dinucleotide: T109 (= T109), G134 (= G134), T135 (≠ R135), Q136 (≠ L136), Y156 (≠ W156), D157 (≠ G157), V158 (≠ R158), R159 (≠ S159), T195 (= T199), P196 (≠ G200), G217 (= G221), D219 (≠ H223), K223 (≠ R227), S290 (= S295), T291 (≠ V296), G292 (= G297)
Sites not aligning to the query:
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
27% identity, 83% coverage: 52:312/314 of query aligns to 54:307/322 of O28608
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
32% identity, 81% coverage: 59:311/314 of query aligns to 63:307/320 of A1B8Z0
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 81% coverage: 59:311/314 of query aligns to 65:309/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ G70)
- binding nicotinamide-adenine-dinucleotide: T113 (= T109), G138 (= G134), Q140 (≠ L136), P162 (≠ R158), H163 (≠ S159), I199 (≠ A198), T200 (= T199), S201 (≠ G200), S202 (≠ A201), M221 (≠ V220), G222 (= G221), D224 (≠ H223), K228 (≠ R227), G293 (≠ S295), T294 (≠ V296), G295 (= G297)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 81% coverage: 59:311/314 of query aligns to 65:309/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ L81), T113 (= T109), G138 (= G134), H139 (≠ R135), Q140 (≠ L136), N161 (≠ G157), P162 (≠ R158), H163 (≠ S159), M166 (≠ K162), I199 (≠ A198), T200 (= T199), S201 (≠ G200), S202 (≠ A201), M221 (≠ V220), G222 (= G221), D224 (≠ H223), K228 (≠ R227), G293 (≠ S295)
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
26% identity, 94% coverage: 18:312/314 of query aligns to 25:309/341 of 1u7hA
- active site: E55 (≠ A50), D227 (≠ H223)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S80), R111 (= R108), T112 (= T109), G137 (= G134), A138 (≠ R135), Q139 (≠ L136), D160 (≠ G157), T161 (≠ R158), V200 (≠ A198), T201 (= T199), A202 (≠ G200), I209 (≠ L205), V224 (= V220), G225 (= G221), D227 (≠ H223), K231 (≠ R227), S292 (= S295), V293 (= V296), G294 (= G297)
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
26% identity, 94% coverage: 18:312/314 of query aligns to 25:309/340 of 1x7dA
- active site: E55 (≠ A50), D227 (≠ H223)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S80), R111 (= R108), T112 (= T109), G137 (= G134), A138 (≠ R135), Q139 (≠ L136), D160 (≠ G157), T161 (≠ R158), V200 (≠ A198), T201 (= T199), A202 (≠ G200), I209 (≠ L205), V224 (= V220), G225 (= G221), D227 (≠ H223), K231 (≠ R227), S292 (= S295), V293 (= V296), G294 (= G297)
- binding L-ornithine: R44 (≠ V37), V53 (vs. gap), E55 (≠ A50), M57 (≠ L52), K68 (= K63), V70 (≠ F65), N71 (≠ T66), G72 (≠ Y67), R111 (= R108), D227 (≠ H223), V293 (= V296)
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
26% identity, 94% coverage: 18:312/314 of query aligns to 26:310/350 of Q88H32
- R45 (≠ V37) binding
- K69 (= K63) binding
- T84 (≠ S80) binding
- R112 (= R108) binding ; binding
- AQ 139:140 (≠ RL 135:136) binding
- D161 (≠ G157) binding
- T202 (= T199) binding
- VGGD 225:228 (≠ VGNH 220:223) binding
- D228 (≠ H223) binding
- K232 (≠ R227) binding
- S293 (= S295) binding
- V294 (= V296) binding
Sites not aligning to the query:
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
24% identity, 94% coverage: 17:312/314 of query aligns to 29:321/334 of 4mp6A
- active site: I60 (≠ A50), M236 (≠ R228)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ S80), R120 (= R108), T121 (= T109), G146 (= G134), L147 (≠ R135), I148 (≠ L136), D170 (≠ G157), Q171 (≠ R158), C211 (≠ A198), T212 (= T199), V213 (≠ G200), I233 (≠ H225), G306 (= G297)
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
23% identity, 94% coverage: 17:312/314 of query aligns to 29:305/318 of 4mpdA
- active site: I53 (≠ A50), M224 (≠ R228)
- binding 2-oxoglutaric acid: K43 (≠ G31), R51 (≠ A48), M55 (≠ L52), K64 (= K63), I66 (≠ F65), R80 (≠ S80), M289 (≠ V296)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ S80), R108 (= R108), T109 (= T109), G134 (= G134), I136 (≠ L136), D158 (≠ G157), Q159 (≠ R158), F160 (≠ S159), T200 (= T199), V201 (≠ G200), I221 (≠ H225)
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
22% identity, 94% coverage: 17:312/314 of query aligns to 29:297/310 of 4m54A
- active site: I55 (≠ A50), M231 (≠ R228)
- binding N-[(2S)-2-amino-2-carboxyethyl]-L-glutamic acid: Y45 (≠ P33), R53 (≠ A48), M57 (≠ L52), K71 (≠ T66), I73 (≠ F68), R87 (≠ S80), R115 (= R108)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R87 (≠ S80), T116 (= T109), G141 (= G134), L142 (≠ R135), I143 (≠ L136), D165 (≠ G157), Q166 (≠ R158), T207 (= T199), T209 (≠ A201), I228 (≠ H225)
5gziA Cyclodeaminase_pa
28% identity, 81% coverage: 60:314/314 of query aligns to 78:324/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (= Y67), T97 (≠ S80), R125 (= R108), T126 (= T109), G151 (= G134), A152 (≠ R135), Q153 (≠ L136), D174 (≠ S159), T175 (≠ P160), H179 (≠ D164), A212 (= A198), T213 (= T199), S214 (≠ G200), V215 (vs. gap), V237 (= V220), G238 (= G221), A239 (≠ S232), S305 (= S295), T306 (≠ V296), G307 (= G297)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K63), R125 (= R108), A239 (≠ S232), T306 (≠ V296), G307 (= G297)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
28% identity, 81% coverage: 60:314/314 of query aligns to 78:324/357 of 5gzlA
- binding lysine: D240 (≠ E233), R267 (≠ S260), E268 (= E261)
- binding nicotinamide-adenine-dinucleotide: Y85 (= Y67), T97 (≠ S80), I98 (≠ L81), T126 (= T109), G151 (= G134), A152 (≠ R135), Q153 (≠ L136), D174 (≠ S159), T175 (≠ P160), H179 (≠ D164), A212 (= A198), T213 (= T199), S214 (≠ G200), V222 (≠ L205), V237 (= V220), G238 (= G221), A239 (≠ S232), D240 (≠ E233), K244 (= K237), S305 (= S295), T306 (≠ V296), G307 (= G297)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
28% identity, 81% coverage: 60:314/314 of query aligns to 74:320/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (= K63), R121 (= R108), T302 (≠ V296), G303 (= G297)
- binding nicotinamide-adenine-dinucleotide: Y81 (= Y67), T93 (≠ S80), I94 (≠ L81), R121 (= R108), T122 (= T109), G147 (= G134), A148 (≠ R135), Q149 (≠ L136), D170 (≠ S159), T171 (≠ P160), H175 (≠ D164), A208 (= A198), T209 (= T199), S210 (≠ G200), V211 (vs. gap), V218 (≠ L205), V233 (= V220), A235 (≠ S232), S301 (= S295), T302 (≠ V296), G303 (= G297)
Sites not aligning to the query:
Query Sequence
>5210527 FitnessBrowser__PV4:5210527
MQVIDAEAVHQALDFPSLTAALRDTFAQPAGMPQRQVFPLDDSSHSDAFAVLPAWNQKTI
AVKAFTYFPGNPKKSPELESLYSKILIFNRETGEPQALVDGTSVTYWRTAAISALASQYL
SRSDAKHLLLFGTGRLATFMALAHASVRQLKTITVWGRSPDKVDKTISAIQAAAPQIEVK
ACEDLPKAVAAADIISCATGAPAPLFDSAWVAPGTHVDLVGNHNHDRRECDSELVVKAEV
YVDAKVNVFAEAGELLIPVSEGVFELSQVKGELADLCRGDIPGRQGEQGITLFKSVGTAL
ADLVGAQLVYEKQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory