SitesBLAST
Comparing 5210546 FitnessBrowser__PV4:5210546 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
41% identity, 98% coverage: 3:179/180 of query aligns to 3:185/185 of 3nz2J
- binding acetyl coenzyme *a: G104 (= G98), Y110 (= Y104), H114 (= H108), W138 (= W132), G140 (= G134), A158 (= A152), A159 (= A153), N164 (≠ T158), G174 (= G168), T176 (≠ N170), P177 (= P171), R182 (= R176)
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
42% identity, 98% coverage: 4:179/180 of query aligns to 1:182/183 of 3nz2C
- binding acetyl coenzyme *a: Y107 (= Y104), H111 (= H108), G137 (= G134), A155 (= A152), A156 (= A153), N161 (≠ T158), G171 (= G168), T173 (≠ N170), P174 (= P171), L178 (≠ I175), R179 (= R176)
- binding magnesium ion: N157 (≠ G154), T173 (≠ N170)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
43% identity, 97% coverage: 5:179/180 of query aligns to 4:187/188 of 3igjC
- binding acetyl coenzyme *a: F84 (= F76), A106 (≠ G98), Y112 (= Y104), A114 (= A106), H116 (= H108), G142 (= G134), N148 (≠ L140), A160 (= A152), S161 (≠ A153), T166 (= T158), N178 (= N170)
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
40% identity, 98% coverage: 4:179/180 of query aligns to 2:185/186 of 4isxA
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
41% identity, 96% coverage: 7:179/180 of query aligns to 1:175/176 of 3ectA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
41% identity, 81% coverage: 35:179/180 of query aligns to 41:185/190 of 5u2kA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
37% identity, 96% coverage: 7:178/180 of query aligns to 14:184/200 of 1krrA
- binding acetyl coenzyme *a: N84 (= N78), I103 (= I97), A104 (≠ G98), P105 (= P99), T112 (≠ A106), H114 (= H108), G140 (= G134), S141 (≠ G135), N146 (≠ L140), G158 (≠ A152), A159 (= A153), A174 (≠ G168), P177 (= P171), R182 (= R176)
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
37% identity, 96% coverage: 7:178/180 of query aligns to 14:184/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: D16 (≠ K9), R25 (≠ C18), S70 (= S64), Y82 (≠ F76), N84 (= N78), V90 (≠ Q84), D92 (≠ N86), M126 (≠ E120)
- binding coenzyme a: A104 (≠ G98), S110 (≠ Y104), T112 (≠ A106), W138 (= W132), G140 (= G134), S141 (≠ G135), N146 (≠ L140), A159 (= A153), P177 (= P171), R179 (= R173), R182 (= R176)
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
37% identity, 96% coverage: 7:178/180 of query aligns to 14:184/201 of 1kruA
- binding coenzyme a: H114 (= H108), W138 (= W132), G140 (= G134), S141 (≠ G135), G158 (≠ A152), A159 (= A153), P177 (= P171), R182 (= R176)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: D16 (≠ K9), P22 (≠ E15), R25 (≠ C18), W62 (≠ V56), S70 (= S64), Y82 (≠ F76), Y82 (≠ F76), N84 (= N78), V90 (≠ Q84), D92 (≠ N86), L102 (≠ M96), H114 (= H108), M126 (≠ E120)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 96% coverage: 7:178/180 of query aligns to 15:185/203 of P07464
- D17 (≠ K9) binding
- S71 (= S64) binding
- N85 (= N78) binding in other chain; binding in other chain
- D93 (≠ N86) binding
- H115 (= H108) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ G135) binding in other chain
- A160 (= A153) binding in other chain
- TK 165:166 (= TK 158:159) binding
- R180 (= R173) binding
- R183 (= R176) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
43% identity, 49% coverage: 89:176/180 of query aligns to 60:164/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
43% identity, 49% coverage: 89:176/180 of query aligns to 60:164/211 of 4hurA
- binding acetyl coenzyme *a: S67 (≠ M96), I68 (= I97), G69 (= G98), A79 (= A106), N80 (= N107), K110 (≠ A122), W120 (= W132), I121 (= I133), G122 (= G134), R123 (≠ G135), M128 (≠ L140), A140 (= A152), A141 (= A153), T146 (= T158), G156 (= G168), P159 (= P171), I163 (= I175), R164 (= R176)
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
43% identity, 49% coverage: 89:176/180 of query aligns to 60:164/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: H91 (vs. gap), L92 (vs. gap), M101 (vs. gap), P102 (vs. gap), L107 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G98), A79 (= A106), H81 (= H108), W120 (= W132), G122 (= G134)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53, 55
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
43% identity, 49% coverage: 89:176/180 of query aligns to 60:164/203 of 6x3cE
- binding magnesium ion: N158 (= N170), P159 (= P171)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (vs. gap), N80 (= N107), H81 (= H108), H91 (vs. gap), L92 (vs. gap), M101 (vs. gap), P102 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G98), H81 (= H108), M83 (≠ L110), W120 (= W132), G122 (= G134), A140 (= A152), A141 (= A153)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
43% identity, 49% coverage: 89:176/180 of query aligns to 60:164/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (vs. gap), N80 (= N107), H81 (= H108), H91 (vs. gap), L92 (vs. gap), M101 (vs. gap), P102 (vs. gap), L104 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G98), N80 (= N107), H81 (= H108), W120 (= W132), G122 (= G134), R123 (≠ G135), M128 (≠ L140), A140 (= A152), A141 (= A153)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
39% identity, 51% coverage: 86:177/180 of query aligns to 58:166/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: N81 (= N107), H82 (= H108), L93 (vs. gap), M102 (vs. gap), L108 (vs. gap)
Sites not aligning to the query:
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: 37, 39, 54, 56
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
39% identity, 51% coverage: 86:177/180 of query aligns to 58:166/205 of 1kk4A
- binding acetyl coenzyme *a: I69 (= I97), G70 (= G98), K111 (≠ A122), W121 (= W132), G123 (= G134), K124 (≠ G135), A141 (= A152), A142 (= A153), V147 (≠ T158), K148 (= K159), L155 (≠ V166), G157 (= G168), G158 (= G169), P160 (= P171), I164 (= I175)
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
39% identity, 51% coverage: 86:177/180 of query aligns to 58:166/206 of 1khrA
- binding coenzyme a: H82 (= H108), M84 (≠ L110), W121 (= W132), A141 (= A152), A142 (= A153), V147 (≠ T158), L155 (≠ V166), G157 (= G168), P160 (= P171), I164 (= I175)
- binding virginiamycin m1: A80 (= A106), N81 (= N107), H82 (= H108), L93 (vs. gap)
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
39% identity, 51% coverage: 86:177/180 of query aligns to 58:166/203 of 3dhoA
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
39% identity, 51% coverage: 86:177/180 of query aligns to 58:166/209 of P50870
- H82 (= H108) mutation to A: 105-fold decrease in activity.
Query Sequence
>5210546 FitnessBrowser__PV4:5210546
MEEVSEFDKMVSGQEYNCLDGELQSRWQARQQANAEMNRRGEVDNELLPHLDAKAVVKLP
LYISYGQNLHVAPQVFINVNVTLQDNAPITIGRQTMIGPNVQCYTANHPLDAARRCQGWE
LAEAIHIGERVWIGGGAIILPGVTIGDEAVVAAGAVVTKDVPPKTVVGGNPARVIRHLEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory