Comparing 5210586 FitnessBrowser__PV4:5210586 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
35% identity, 95% coverage: 9:356/366 of query aligns to 7:357/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
35% identity, 95% coverage: 9:356/366 of query aligns to 5:355/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
29% identity, 95% coverage: 9:356/366 of query aligns to 5:315/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
29% identity, 95% coverage: 9:356/366 of query aligns to 5:313/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
35% identity, 67% coverage: 7:253/366 of query aligns to 1:240/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 68% coverage: 5:254/366 of query aligns to 11:257/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
35% identity, 68% coverage: 5:254/366 of query aligns to 11:235/236 of 7f5xA
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
28% identity, 37% coverage: 109:244/366 of query aligns to 167:297/468 of 3c1mC
Sites not aligning to the query:
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
28% identity, 37% coverage: 109:244/366 of query aligns to 167:297/464 of 2hmfA
Sites not aligning to the query:
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
28% identity, 37% coverage: 109:244/366 of query aligns to 166:296/458 of 3c1nA
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
30% identity, 30% coverage: 147:255/366 of query aligns to 121:226/226 of 2bmuB
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
30% identity, 30% coverage: 147:255/366 of query aligns to 120:225/225 of Q8U122
Sites not aligning to the query:
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
23% identity, 54% coverage: 50:248/366 of query aligns to 64:247/253 of 7n9dA
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
27% identity, 35% coverage: 122:248/366 of query aligns to 126:251/261 of 7lnuB
Sites not aligning to the query:
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
27% identity, 35% coverage: 122:248/366 of query aligns to 125:250/260 of 7lntB
Sites not aligning to the query:
3ll9B X-ray structures of isopentenyl phosphate kinase (see paper)
28% identity, 37% coverage: 121:254/366 of query aligns to 129:249/249 of 3ll9B
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
29% identity, 30% coverage: 147:255/366 of query aligns to 122:219/219 of 2ji5A
Sites not aligning to the query:
>5210586 FitnessBrowser__PV4:5210586
MANIHWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFIANCRAQGVQVVLVSSGSVAAGWH
RLGDVKQPSVSQKKAMAAAGQADMMATWDKLFDFPSAQLLVTHGDLRDRERYISIKNTLF
SLLDHGLLPIVNENDAVTTDTLRVGDNDNLSAMVAAAADADALIICSDVNGLYTKNPQLH
DDAKLIKQVNEINEAIYAMAGGATSEVGTGGMRTKIEAAEKAIAHGIETVIINGFDPDAF
NRLLKGQNPGTLFTPFDQPMQEHVHWMTHTSQAQGEVIVEDNFDAPLDDQETQLTSDDVV
AVKGNFSVGDTILVRKGDGTKLAKAQANYSSCLLSFIAKQPDRAFAHDVEQQTGPILSDE
NIAILE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory