SitesBLAST
Comparing 5210687 FitnessBrowser__PV4:5210687 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 94% coverage: 18:428/437 of query aligns to 2:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A286), S275 (= S287), S276 (= S288), T313 (≠ V325), G353 (= G365), V354 (= V366), A357 (≠ G369), G358 (= G370), D394 (= D399), R397 (≠ L402), T398 (= T403)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K205), G198 (≠ V209), Y202 (≠ L213)
- binding sodium ion: Y87 (= Y105), T90 (≠ N108), S91 (≠ T109), S276 (= S288), G305 (= G317), A306 (= A318), T307 (= T319), N309 (= N321), N309 (= N321), M310 (= M322), D311 (≠ G323), S348 (= S360), I349 (≠ V361), G350 (= G362), T351 (≠ A363), N401 (= N406), V402 (= V407), D405 (= D410)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 94% coverage: 18:428/437 of query aligns to 2:423/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 94% coverage: 20:428/437 of query aligns to 1:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (= L22), L191 (≠ K205), G195 (≠ V209), R282 (= R297)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A286), S272 (= S287), S273 (= S288), M307 (= M322), T310 (≠ V325), G353 (= G368), A354 (≠ G369), R394 (≠ L402), T395 (= T403)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 94% coverage: 20:428/437 of query aligns to 2:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 91% coverage: 33:428/437 of query aligns to 10:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A286), S265 (= S288), M299 (= M322), T302 (≠ V325), T340 (≠ A363), G342 (= G365), V343 (= V366), G347 (= G370), D383 (= D399), R386 (≠ L402), T387 (= T403), N390 (= N406)
- binding decyl-beta-d-maltopyranoside: H23 (≠ D46), V212 (≠ F234), A216 (≠ V238)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
32% identity, 89% coverage: 33:421/437 of query aligns to 16:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G84), V83 (≠ F102), I157 (≠ L177), Y164 (vs. gap), K193 (= K205), T305 (= T319), I306 (≠ M320), I347 (≠ V361)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (= M211), S275 (= S288), T311 (≠ V325), G356 (= G370), L384 (≠ A392), D391 (= D399), R394 (≠ L402)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
32% identity, 89% coverage: 33:421/437 of query aligns to 19:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L61), F46 (≠ L61), P75 (≠ D90), L91 (≠ I107), F95 (≠ V111), L130 (= L147), I133 (≠ L150), I159 (≠ L176), Y167 (vs. gap), K196 (= K205), G200 (≠ V209), I207 (= I216), F210 (= F219), L250 (≠ V254), I262 (≠ R272), M269 (≠ I279), T334 (≠ A345), V335 (≠ M346), G336 (≠ D347), T340 (≠ A351), L343 (≠ F354), M399 (≠ S404)
- binding aspartic acid: S277 (= S287), S278 (= S288), T314 (≠ V325), G354 (= G365), A358 (≠ G369), G359 (= G370), D394 (= D399), R397 (≠ L402), T398 (= T403)
- binding sodium ion: Y89 (= Y105), T92 (≠ N108), S93 (≠ T109), G306 (= G317), T308 (= T319), N310 (= N321), N310 (= N321), M311 (= M322), D312 (≠ G323), S349 (= S360), I350 (≠ V361), T352 (≠ A363), N401 (= N406), V402 (= V407), D405 (= D410)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
32% identity, 89% coverage: 33:421/437 of query aligns to 10:407/407 of 2nwwA
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
31% identity, 94% coverage: 16:426/437 of query aligns to 6:421/425 of O59010
- S65 (= S80) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A286) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 286:288) binding
- M311 (= M322) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ V325) binding
- V355 (= V366) binding
- D394 (= D399) binding
- M395 (= M400) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ L402) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N406) binding
- D405 (= D410) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
32% identity, 89% coverage: 33:421/437 of query aligns to 11:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
32% identity, 89% coverage: 33:421/437 of query aligns to 11:408/408 of 6bauA
- binding cysteine: S270 (= S288), M303 (= M322), T306 (≠ V325), A345 (≠ G364), G346 (= G365), V347 (= V366), G351 (= G370), D386 (= D399), C389 (≠ L402), T390 (= T403), N393 (= N406)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
31% identity, 89% coverage: 33:421/437 of query aligns to 11:396/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 93% coverage: 32:437/437 of query aligns to 27:480/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 84% coverage: 62:429/437 of query aligns to 57:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ F94), G89 (= G95), G92 (= G98), A95 (≠ T101), V96 (≠ F102), Y99 (= Y105), M163 (≠ L176), F167 (≠ G180), F293 (= F312), V297 (≠ L316)
- binding aspartic acid: S268 (= S287), S269 (= S288), T306 (≠ V325), G346 (= G365), I347 (≠ V366), A350 (≠ G369), G351 (= G370), D380 (= D399), R383 (≠ L402), T384 (= T403)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 84% coverage: 62:429/437 of query aligns to 49:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V85), S80 (≠ F94), G81 (= G95), G84 (= G98), Y91 (= Y105), M156 (≠ L176), F160 (≠ G180), F286 (= F312), V290 (≠ L316)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V77), I148 (≠ M168), S262 (= S288), S263 (≠ N289), A292 (= A318), T293 (= T319), M296 (= M322), T299 (≠ V325), G329 (= G362), A336 (≠ G369), G337 (= G370), D366 (= D399), R369 (≠ L402), N373 (= N406)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 92% coverage: 9:411/437 of query aligns to 1:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S287), S281 (= S288), T318 (≠ V325), G363 (= G370), M367 (≠ I374), V385 (≠ A392), D388 (= D395), R395 (≠ L402), T396 (= T403)
- binding dodecyl beta-D-glucopyranoside: V16 (≠ I26), V19 (≠ L34), I20 (= I35), W389 (≠ R396)
- binding cholesterol hemisuccinate: R80 (= R96), R84 (≠ K100), I95 (≠ V111), I252 (≠ A259)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
29% identity, 80% coverage: 62:411/437 of query aligns to 46:405/425 of 7xr4A
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
28% identity, 80% coverage: 62:411/437 of query aligns to 79:468/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
29% identity, 80% coverage: 62:411/437 of query aligns to 39:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S80), L58 (≠ I81), L65 (= L88), V339 (= V361), G340 (= G362), S343 (≠ G365), I344 (≠ V366)
- binding cholesterol: W188 (≠ Q212), I227 (≠ L249), F250 (≠ R272), W257 (≠ I279), M379 (≠ V401), S382 (= S404)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S288), M300 (= M322), T303 (≠ V325), Y306 (= Y328), G348 (= G370), L349 (≠ M371), M352 (≠ I374), I366 (≠ F388), L369 (≠ V391), V370 (≠ A392), D373 (= D395), D377 (= D399), R380 (≠ L402), T381 (= T403), N384 (= N406)
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 92% coverage: 11:411/437 of query aligns to 29:488/542 of P43003
- S363 (≠ A286) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 286:288) binding
- T396 (= T319) binding
- T402 (≠ V325) binding
- IPQAG 443:447 (≠ VPGGG 366:370) binding
- D476 (= D399) binding
- R477 (≠ M400) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N406) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
Query Sequence
>5210687 FitnessBrowser__PV4:5210687
MEKKKAHDRCATKQGKHMTKSLSTRIFIGLFSGLILGSIIQYFLADVGFFSGTLVEVASG
LGTMFVNMIMMMVVPLVFVSIVCGVLELDDLKSFGRLGGKTFGFYIINTLVAIFAALTVA
LLLKPGLGVDMTGGTGAEITATELPNLMQLIVNIVPSNPVAAFTSGNMLQVIFMALLVGG
VIKAMNGAVPLLQQGFMEGNKLMMKLIGVVMQLAPIGVFALMFKLGATLEASLFLSVVEY
LVVILSLLLLWIFVVYPWAVSLFTPVSAKTFRAKTQEQILFSLSTASSNATIPVTMRTLT
EKLGVKRAVAGFGVPLGATMNMGGVSIYITIAIFFVANSFGAPIAMDQLPALLFSIFLLS
VGAGGVPGGGMVMIGVLIHQMGLPVEAFVIVAALDRLIDMVLTSCNVVGDAAVLTIVDAT
ENAHDEAQEEARQQQTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory