Comparing 5210738 FitnessBrowser__PV4:5210738 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
46% identity, 88% coverage: 26:239/242 of query aligns to 6:221/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
45% identity, 88% coverage: 26:239/242 of query aligns to 6:223/226 of 4zv1A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
44% identity, 91% coverage: 21:241/242 of query aligns to 7:227/229 of 6svfA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
40% identity, 90% coverage: 26:242/242 of query aligns to 3:223/224 of 4ymxA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
41% identity, 90% coverage: 26:242/242 of query aligns to 12:229/229 of 5t0wA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
38% identity, 92% coverage: 20:241/242 of query aligns to 1:224/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
38% identity, 92% coverage: 20:241/242 of query aligns to 7:230/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 89% coverage: 26:241/242 of query aligns to 3:220/231 of 2q2cA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
36% identity, 92% coverage: 21:242/242 of query aligns to 5:232/237 of 4i62A
Q9Z869 Probable ABC transporter arginine-binding protein ArtJ from Chlamydia pneumoniae (Chlamydophila pneumoniae) (see paper)
34% identity, 95% coverage: 10:240/242 of query aligns to 14:251/259 of Q9Z869
3qaxB Crystal structure analysis of the cpb0502
35% identity, 88% coverage: 27:239/242 of query aligns to 7:223/235 of 3qaxB
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
34% identity, 92% coverage: 20:241/242 of query aligns to 10:234/235 of 4g4pA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
36% identity, 92% coverage: 21:242/242 of query aligns to 14:237/239 of 4zefA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
33% identity, 88% coverage: 26:239/242 of query aligns to 8:225/228 of 2y7iA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
31% identity, 91% coverage: 22:242/242 of query aligns to 4:227/230 of 4kqpA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
35% identity, 88% coverage: 26:239/242 of query aligns to 6:224/234 of 3k4uE
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
33% identity, 90% coverage: 21:239/242 of query aligns to 8:233/240 of 4h5fA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
33% identity, 89% coverage: 26:241/242 of query aligns to 5:221/226 of 8eyzA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
32% identity, 88% coverage: 28:240/242 of query aligns to 7:222/226 of 6fxgB
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
32% identity, 88% coverage: 28:240/242 of query aligns to 6:221/225 of 8b5eA
>5210738 FitnessBrowser__PV4:5210738
MNKSILLAGFTALLLLSGCGKEQDYLVVGTNAAFPPFEYVGGVSGDQVMGFDIDLARKVA
EDAGKTLKVENMKFDSLIVALNAGKIDMIASGMTITPERQASVDFSEPYYEATQVVLVNK
QDDSIHSLADLTGKHFAVQLGSTADMMAKKYTQSVTAFNTGFEAIMELKNGKVDLVLFDS
EPAANYLAKNPELKLISLDFPPEFYGFAVAKSQPELLASINKTLATMKQNGEYDALLAKH
MK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory