Comparing 5210878 FitnessBrowser__PV4:5210878 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
62% identity, 89% coverage: 31:289/292 of query aligns to 4:262/262 of 7chaI
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
65% identity, 90% coverage: 27:288/292 of query aligns to 1:262/265 of 7ch6C
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
65% identity, 90% coverage: 27:288/292 of query aligns to 1:262/264 of 6xgyA
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
65% identity, 90% coverage: 27:288/292 of query aligns to 1:262/263 of 7cgnB
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
61% identity, 88% coverage: 27:283/292 of query aligns to 1:257/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
61% identity, 88% coverage: 27:283/292 of query aligns to 1:257/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
61% identity, 86% coverage: 30:281/292 of query aligns to 2:253/253 of 6z5uK
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
61% identity, 89% coverage: 31:289/292 of query aligns to 4:259/259 of 7ch8I
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 85% coverage: 30:276/292 of query aligns to 84:345/345 of Q9AT00
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 87% coverage: 14:268/292 of query aligns to 2:246/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 87% coverage: 38:290/292 of query aligns to 11:260/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 91% coverage: 26:290/292 of query aligns to 1:261/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 91% coverage: 26:290/292 of query aligns to 1:261/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 91% coverage: 26:290/292 of query aligns to 1:261/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 77% coverage: 41:266/292 of query aligns to 37:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 77% coverage: 41:266/292 of query aligns to 37:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
36% identity, 71% coverage: 48:254/292 of query aligns to 44:250/260 of 7ahdC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 76% coverage: 38:260/292 of query aligns to 13:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 76% coverage: 38:260/292 of query aligns to 13:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 76% coverage: 38:260/292 of query aligns to 13:232/353 of 1oxuA
>5210878 FitnessBrowser__PV4:5210878
MSHQSLSHDSQAKGETKPMEQAPMEHVQPLVEISHLGFSRGTHVIYDDVSLTIPRGKVTA
IMGPSGIGKTTLLKLIGGQLRPDSGVIKVDGVDVHKCNRSELFALRKRMSMLFQSGALFT
DMNVFDNVAFALREHSDLPEAIIRRIVLMKLEAVGLRGAAQMMPSELSGGMQRRAALARA
IALEPELVLYDEPFAGQDPISMGVLVKLIRELSDALSLTSVVVSHDVQEVLGIADYVYVL
ADKKVIAHGTPAELKAADNPKLKQFIGGEPDGPVPFHFPAQDYQKEMLGERD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory