Comparing 5210884 FitnessBrowser__PV4:5210884 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
78% identity, 98% coverage: 5:243/243 of query aligns to 2:240/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
74% identity, 98% coverage: 6:243/243 of query aligns to 4:241/241 of 6mbnA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
75% identity, 97% coverage: 6:241/243 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
75% identity, 97% coverage: 6:241/243 of query aligns to 3:238/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
75% identity, 96% coverage: 6:238/243 of query aligns to 3:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
75% identity, 95% coverage: 6:237/243 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
75% identity, 95% coverage: 6:237/243 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
75% identity, 95% coverage: 6:236/243 of query aligns to 3:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
36% identity, 98% coverage: 1:238/243 of query aligns to 2:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 97% coverage: 5:239/243 of query aligns to 4:254/254 of 1g6hA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 93% coverage: 2:226/243 of query aligns to 1:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
32% identity, 93% coverage: 2:226/243 of query aligns to 1:228/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 91% coverage: 5:226/243 of query aligns to 2:226/253 of 6z5uK
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 96% coverage: 5:238/243 of query aligns to 4:253/253 of 1g9xB
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
33% identity, 93% coverage: 1:226/243 of query aligns to 1:223/285 of 4yerA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 90% coverage: 10:227/243 of query aligns to 6:224/240 of 4ymuJ
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
33% identity, 90% coverage: 5:222/243 of query aligns to 2049:2268/2435 of Q9BZC7
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 92% coverage: 5:228/243 of query aligns to 1:217/348 of 3d31A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 93% coverage: 5:231/243 of query aligns to 3:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 93% coverage: 5:231/243 of query aligns to 3:230/242 of 3c41J
>5210884 FitnessBrowser__PV4:5210884
MTDLILKAENLAKSYKSRAVVQDVSLTVKTGQIVGLLGPNGAGKTTTFYMVVGLVQSDKG
RIFIDDDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQTRSDLNNDGREEEL
EHLLEEFHITHIRDSHGMALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKK
IIEQLKNRGLGVLITDHNVRETLDVCEKAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQ
FKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory