Comparing 5210887 FitnessBrowser__PV4:5210887 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
28% identity, 99% coverage: 2:147/147 of query aligns to 501:648/650 of O31645
Sites not aligning to the query:
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
37% identity, 50% coverage: 50:122/147 of query aligns to 554:626/648 of O31644
Sites not aligning to the query:
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
23% identity, 71% coverage: 42:145/147 of query aligns to 530:633/637 of P00550
Sites not aligning to the query:
P46321 Probable licABCH operon regulator; EC 2.7.1.- from Bacillus subtilis (strain 168) (see paper)
28% identity, 75% coverage: 38:147/147 of query aligns to 531:637/641 of P46321
Sites not aligning to the query:
>5210887 FitnessBrowser__PV4:5210887
MELSTILRPECTTCATPGSKKKVLELISDLAAVQYPTLSSQEIFESLLAREKMGSTGIGN
GIAIPHGRLTNIDQPVAVLVKCAEPIAFDAIDNQPVDILFALLVPADQCEQHLSTLAAMA
EKLNDKAIMKQLRKTQDESELYQVITQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory