Comparing 5210999 FitnessBrowser__PV4:5210999 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1te2A Putative phosphatase ynic from escherichia coli k12
45% identity, 92% coverage: 8:213/223 of query aligns to 5:211/218 of 1te2A
P77247 Hexitol phosphatase B; 2-deoxyglucose-6-phosphate phosphatase; Mannitol-1-phosphatase; Sorbitol-6-phosphatase; Sugar-phosphatase; EC 3.1.3.68; EC 3.1.3.22; EC 3.1.3.50; EC 3.1.3.23 from Escherichia coli (strain K12) (see paper)
45% identity, 92% coverage: 8:213/223 of query aligns to 9:215/222 of P77247
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 83% coverage: 6:189/223 of query aligns to 74:260/1055 of Q8VZ10
Sites not aligning to the query:
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
26% identity, 94% coverage: 10:219/223 of query aligns to 13:217/675 of 7ocrB
Sites not aligning to the query:
7ocqB Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 94% coverage: 10:219/223 of query aligns to 13:218/679 of 7ocqB
Sites not aligning to the query:
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 94% coverage: 10:219/223 of query aligns to 13:223/690 of 7ocnA
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 94% coverage: 10:219/223 of query aligns to 13:223/686 of 7ocqA
Sites not aligning to the query:
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 94% coverage: 10:219/223 of query aligns to 13:223/688 of 7ocpA
Sites not aligning to the query:
7ocsC Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
27% identity, 94% coverage: 10:219/223 of query aligns to 13:223/572 of 7ocsC
7ocsA Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
27% identity, 94% coverage: 10:219/223 of query aligns to 13:223/682 of 7ocsA
Sites not aligning to the query:
3dv9A Putative beta-phosphoglucomutase from bacteroides vulgatus.
31% identity, 83% coverage: 4:189/223 of query aligns to 21:205/243 of 3dv9A
4uasA Crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate (see paper)
26% identity, 94% coverage: 6:214/223 of query aligns to 2:218/225 of 4uasA
P95649 Protein CbbY; RuCbby; EC 3.1.3.- from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
26% identity, 94% coverage: 6:214/223 of query aligns to 2:218/230 of P95649
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
27% identity, 91% coverage: 1:202/223 of query aligns to 1:205/226 of Q9HZ62
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
27% identity, 87% coverage: 4:197/223 of query aligns to 2:199/227 of 4g9bA
4uauA Crystal structure of cbby (mutant d10n) from rhodobacter sphaeroides in complex with xylulose-(1,5)bisphosphate, crystal form ii (see paper)
26% identity, 94% coverage: 6:214/223 of query aligns to 2:218/226 of 4uauA
2fdrA Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. C58
28% identity, 80% coverage: 9:187/223 of query aligns to 5:182/222 of 2fdrA
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
27% identity, 79% coverage: 6:182/223 of query aligns to 1:180/223 of 6w04A
4eenA Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
31% identity, 74% coverage: 8:172/223 of query aligns to 6:170/229 of 4eenA
3qypB Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with calcium and phosphate (see paper)
27% identity, 83% coverage: 6:189/223 of query aligns to 9:194/228 of 3qypB
>5210999 FitnessBrowser__PV4:5210999
MSQINLAAVIFDMDGVLIDSEPSWQAAEYKVLSQLGLPISLSDTEQTTGLRIDQVVEYWY
RRHPWKGYDNAATAEAIVTQVAGEILSHGEVMSGVKEALEACKQRGLKLGLATSSPTLLI
DAVMQKLAIRELFDAIVSAEALALGKPHPEVYLNCAKALGVTPSQCLAVEDSFNGLIAAR
AANMHTVVIPAPHEASQARWAAAHQQLTSLKEFADYLAQCAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory