SitesBLAST
Comparing 5211288 FitnessBrowser__PV4:5211288 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
60% identity, 96% coverage: 12:352/356 of query aligns to 2:341/355 of P27830
- FI 12:13 (= FI 22:23) binding
- DKLT 33:36 (= DKLT 43:46) binding
- DI 59:60 (= DI 69:70) binding
- T100 (= T110) binding
- D135 (= D145) active site, Proton donor
- E136 (= E146) active site, Proton acceptor
- Y160 (= Y171) active site, Proton acceptor
- YSASK 160:164 (= YSASK 171:175) binding
- N190 (= N201) binding
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
58% identity, 95% coverage: 14:352/356 of query aligns to 3:344/361 of 1kewA
- active site: T133 (= T144), D134 (= D145), E135 (= E146), L152 (≠ A156), L154 (≠ Y158), F155 (= F159), T158 (≠ Q162), Y167 (= Y171), K171 (= K175)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), F11 (= F22), I12 (= I23), D32 (= D43), K33 (= K44), L34 (= L45), T35 (= T46), A37 (= A48), G38 (= G49), D58 (= D69), I59 (= I70), L80 (= L91), A81 (= A92), A82 (= A93), S84 (≠ T95), T99 (= T110), I131 (≠ V142), S132 (= S143), T133 (= T144), Y167 (= Y171), K171 (= K175), C194 (= C198), N196 (= N200), N197 (= N201)
- binding thymidine-5'-diphosphate: E135 (= E146), N196 (= N200), K206 (= K210), L207 (= L211), P222 (= P226), Y224 (= Y228), R231 (= R235), N266 (= N270), R297 (= R305), H300 (= H308)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
58% identity, 95% coverage: 14:352/356 of query aligns to 3:344/361 of 1keuA
- active site: T133 (= T144), D134 (= D145), E135 (= E146), L152 (≠ A156), L154 (≠ Y158), F155 (= F159), T158 (≠ Q162), Y167 (= Y171), K171 (= K175)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (≠ T95), T133 (= T144), D134 (= D145), E135 (= E146), Y167 (= Y171), N196 (= N200), K206 (= K210), L207 (= L211), P222 (= P226), Y224 (= Y228), R231 (= R235), N266 (= N270), R297 (= R305), H300 (= H308)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), F11 (= F22), I12 (= I23), D32 (= D43), K33 (= K44), L34 (= L45), T35 (= T46), G38 (= G49), D58 (= D69), L80 (= L91), A81 (= A92), A82 (= A93), S84 (≠ T95), T99 (= T110), S132 (= S143), T133 (= T144), Y167 (= Y171), K171 (= K175), C194 (= C198), N196 (= N200), N197 (= N201)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
58% identity, 95% coverage: 14:352/356 of query aligns to 3:344/361 of P26391
Sites not aligning to the query:
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
58% identity, 96% coverage: 12:352/356 of query aligns to 2:335/344 of 1bxkB
- active site: S125 (≠ A135), T134 (= T144), D135 (= D145), E136 (= E146), S158 (= S169), Y160 (= Y171), S161 (= S172), K164 (= K175)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (= F22), I13 (= I23), D33 (= D43), K34 (= K44), L35 (= L45), T36 (= T46), A38 (= A48), G39 (= G49), D59 (= D69), I60 (= I70), L81 (= L91), A83 (= A93), T100 (= T110), I132 (≠ V142), S133 (= S143), T134 (= T144), K164 (= K175), C187 (= C198)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
52% identity, 96% coverage: 12:353/356 of query aligns to 4:348/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), G13 (= G21), F14 (= F22), I15 (= I23), D36 (= D43), A37 (≠ K44), L38 (= L45), T39 (= T46), G42 (= G49), D62 (= D69), I63 (= I70), L84 (= L91), A85 (= A92), A86 (= A93), T103 (= T110), S143 (= S143), T144 (= T144), Y169 (= Y171), K173 (= K175), C196 (= C198)
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
44% identity, 94% coverage: 13:348/356 of query aligns to 3:306/311 of 6bi4C
- active site: T117 (= T144), D118 (= D145), E119 (= E146), Y142 (= Y171), K146 (= K175)
- binding beta-D-fructofuranose: Q62 (≠ N71), N63 (≠ D72), G64 (= G73), E65 (≠ D74)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (= F22), I13 (= I23), D34 (= D43), A35 (≠ K44), L36 (= L45), T37 (= T46), S39 (≠ A48), G40 (= G49), E60 (≠ D69), I61 (= I70), Q62 (≠ N71), F82 (≠ L91), A83 (= A92), A84 (= A93), T92 (= T110), V115 (= V142), T117 (= T144), Y142 (= Y171), K146 (= K175), C169 (= C198), S170 (= S199)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
43% identity, 94% coverage: 13:348/356 of query aligns to 3:305/310 of 6bi4B
- active site: T117 (= T144), D118 (= D145), E119 (= E146), Y142 (= Y171), K146 (= K175)
- binding alpha-D-glucopyranose: Q62 (≠ N71), N63 (≠ D72)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (= F22), I13 (= I23), D34 (= D43), A35 (≠ K44), L36 (= L45), T37 (= T46), S39 (≠ A48), G40 (= G49), E60 (≠ D69), F82 (≠ L91), A83 (= A92), A84 (= A93), T92 (= T110), S116 (= S143), T117 (= T144), Y142 (= Y171), K146 (= K175), C169 (= C198)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
44% identity, 96% coverage: 13:355/356 of query aligns to 3:319/329 of 2hunA
- active site: T125 (= T144), D126 (= D145), E127 (= E146), Y149 (= Y171), K153 (= K175)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (= F22), I13 (= I23), D34 (= D43), K35 (= K44), S40 (≠ G49), D60 (= D69), V61 (≠ I70), L80 (= L91), A81 (= A92), A82 (= A93), S99 (≠ T110), T125 (= T144), K153 (= K175), C176 (= C198), T177 (≠ S199), N178 (= N200), N179 (= N201)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
45% identity, 94% coverage: 14:348/356 of query aligns to 3:317/322 of 1r66A
- active site: T127 (= T144), D128 (= D145), E129 (= E146), Y151 (= Y171), K155 (= K175)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), F11 (= F22), I12 (= I23), D37 (= D43), S38 (≠ K44), L39 (= L45), T40 (= T46), G43 (= G49), D63 (= D69), I64 (= I70), F83 (≠ L91), A84 (= A92), A85 (= A93), S87 (≠ T95), T102 (= T110), V125 (= V142), S126 (= S143), Y151 (= Y171), K155 (= K175), N181 (= N201)
- binding thymidine-5'-diphosphate: H88 (= H96), E129 (= E146), N180 (= N200), K190 (= K210), L191 (= L211), P206 (= P226), Y208 (= Y228), R215 (= R235), N250 (= N270), R274 (= R305), H277 (= H308)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
44% identity, 94% coverage: 14:348/356 of query aligns to 3:317/322 of 1r6dA
- active site: T127 (= T144), N128 (≠ D145), Q129 (≠ E146), Y151 (= Y171), K155 (= K175)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ T95), H88 (= H96), T127 (= T144), N128 (≠ D145), Q129 (≠ E146), Y151 (= Y171), N180 (= N200), K190 (= K210), L191 (= L211), P206 (= P226), Y208 (= Y228), R215 (= R235), N250 (= N270), R274 (= R305), H277 (= H308), Y281 (= Y312)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), F11 (= F22), I12 (= I23), D37 (= D43), S38 (≠ K44), L39 (= L45), T40 (= T46), A42 (= A48), G43 (= G49), D63 (= D69), I64 (= I70), F83 (≠ L91), A84 (= A92), A85 (= A93), S87 (≠ T95), T102 (= T110), V125 (= V142), S126 (= S143), Y151 (= Y171), K155 (= K175), N181 (= N201)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
42% identity, 95% coverage: 12:348/356 of query aligns to 5:328/348 of P95780
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
41% identity, 95% coverage: 12:348/356 of query aligns to 4:327/347 of 1kerB
- active site: T124 (= T144), D125 (= D145), E126 (= E146), Y160 (= Y171), K164 (= K175)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (≠ T95), N87 (≠ V97), T124 (= T144), D125 (= D145), E126 (= E146), Y160 (= Y171), N189 (= N200), K199 (= K210), F200 (≠ L211), R203 (≠ V214), Q204 (≠ T215), K215 (≠ P226), L216 (≠ V227), Y217 (= Y228), R224 (= R235), N259 (= N270), R283 (= R305), H286 (= H308)
- binding nicotinamide-adenine-dinucleotide: G13 (= G21), F14 (= F22), I15 (= I23), D36 (= D43), K37 (= K44), L38 (= L45), T39 (= T46), G42 (= G49), D61 (= D69), I62 (= I70), Y81 (≠ L91), A82 (= A92), A83 (= A93), S85 (≠ T95), T100 (= T110), S123 (= S143), T124 (= T144), Y160 (= Y171), K164 (= K175), C187 (= C198), N190 (= N201)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
41% identity, 95% coverage: 12:348/356 of query aligns to 3:326/346 of 1ketA
- active site: T123 (= T144), D124 (= D145), E125 (= E146), Y159 (= Y171), K163 (= K175)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), F13 (= F22), I14 (= I23), D35 (= D43), K36 (= K44), L37 (= L45), T38 (= T46), A40 (= A48), G41 (= G49), D60 (= D69), I61 (= I70), Y80 (≠ L91), A82 (= A93), S84 (≠ T95), T99 (= T110), S122 (= S143), T123 (= T144), Y159 (= Y171), K163 (= K175)
- binding thymidine-5'-diphosphate: E125 (= E146), N188 (= N200), F199 (≠ L211), R202 (≠ V214), Q203 (≠ T215), K214 (≠ P226), Y216 (= Y228), R223 (= R235), N258 (= N270), R282 (= R305), H285 (= H308)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
41% identity, 95% coverage: 12:348/356 of query aligns to 3:326/346 of 1kepA
- active site: T123 (= T144), D124 (= D145), E125 (= E146), Y159 (= Y171), K163 (= K175)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), F13 (= F22), I14 (= I23), D35 (= D43), K36 (= K44), L37 (= L45), T38 (= T46), G41 (= G49), D60 (= D69), I61 (= I70), Y80 (≠ L91), A81 (= A92), A82 (= A93), S84 (≠ T95), T99 (= T110), S122 (= S143), Y159 (= Y171), K163 (= K175), N189 (= N201)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (≠ T95), T123 (= T144), E125 (= E146), Y159 (= Y171), N188 (= N200), K198 (= K210), R223 (= R235), R282 (= R305)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
43% identity, 96% coverage: 13:355/356 of query aligns to 9:328/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G21), F18 (= F22), I19 (= I23), D44 (= D43), S45 (≠ K44), L46 (= L45), T47 (= T46), G50 (= G49), D68 (= D69), I69 (= I70), F88 (≠ L91), A89 (= A92), A90 (= A93), T92 (= T95), T107 (= T110), V130 (= V142), Y156 (= Y171), K160 (= K175), G184 (≠ S199), N186 (= N201)
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
43% identity, 96% coverage: 13:355/356 of query aligns to 8:327/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G21), F17 (= F22), I18 (= I23), D43 (= D43), S44 (≠ K44), L45 (= L45), T46 (= T46), G49 (= G49), D67 (= D69), F87 (≠ L91), A88 (= A92), A89 (= A93), T91 (= T95), T106 (= T110), V129 (= V142), S130 (= S143), T131 (= T144), Y155 (= Y171), K159 (= K175)
- binding thymidine-5'-diphosphate: E133 (= E146), N184 (= N200), K194 (= K210), V195 (≠ L211), P210 (= P226), Y212 (= Y228), R219 (= R235), N254 (= N270), R278 (= R305), H281 (= H308)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 99% coverage: 1:354/356 of query aligns to 1:333/667 of Q9LPG6
- G18 (= G21) mutation to A: Abolishes dehydratase activity.
- K36 (≠ R38) mutation to A: Reduces dehydratase activity.
- D96 (= D98) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K175) mutation to A: Abolishes dehydratase activity.
- G193 (= G203) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
41% identity, 96% coverage: 12:354/356 of query aligns to 7:331/669 of Q9SYM5
- R283 (= R305) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
36% identity, 93% coverage: 12:342/356 of query aligns to 4:312/319 of 6vloA
- active site: T126 (= T144), D127 (= D145), E128 (= E146), Y151 (= Y171), K155 (= K175)
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), G13 (= G21), F14 (= F22), I15 (= I23), D36 (= D43), I37 (≠ K44), A42 (= A52), D59 (= D69), I60 (= I70), F81 (≠ L91), A82 (= A92), A83 (= A93), S85 (≠ T95), M124 (≠ V142), T126 (= T144), K155 (= K175)
- binding thymidine-5'-diphosphate: N180 (= N200), K190 (= K210), L191 (= L211), K194 (≠ V214), H206 (≠ P226), Q208 (≠ Y228), R215 (= R235), V250 (≠ N270), R275 (= R305), R281 (= R311)
Query Sequence
>5211288 FitnessBrowser__PV4:5211288
MNSEQHHPLAGRNILITGGAGFIGSALIRHLIALGGCRVVNYDKLTYAGNLASLESIAQA
PNYHFIQADINDGDTLGGALRQYQIDLVIHLAAETHVDRSIEGPRAFIGTNIVGTFELLQ
QCLDYYRKLPIEIAARFRLHHVSTDEVFGDLGSDEAGYFSEQSPYAPSSPYSASKAAADH
LVRAWHRTYGLPVVLSNCSNNYGPYQYPEKLIPVTLLNALQGKLIPVYGDGKQIRDWLYV
DDHAHALCQVAARGELGESYNIGGMNEMTNLEVVSLICDLLNQKVTEKPCGISDFRQLIG
FVKDRPGHDTRYAIDASKLSRTLGWQPSESFASGLEKTVDWYLTHLDWCHQVAGQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory