Comparing 56 a.a. (MERAFQNRCE...) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O34800 Stage II sporulation protein SB; Antidote protein SpoIISB; Antitoxin SpoIISB from Bacillus subtilis (strain 168) (see paper)
100% identity, 100% coverage: 1:56/56 of query aligns to 1:56/56 of O34800
>56 a.a. (MERAFQNRCE...)
MERAFQNRCEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEYKRKKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory