SitesBLAST
Comparing 59 a.a. (MKVKSAAKKR...) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree
Found 12 hits to proteins with known functional sites (download)
7ood1 Mycoplasma pneumoniae 50s subunit of ribosomes in chloramphenicol- treated cells (see paper)
100% identity, 100% coverage: 1:59/59 of query aligns to 1:59/59 of 7ood1
- binding : K2 (= K2), V3 (= V3), K4 (= K4), S5 (= S5), A6 (= A6), K8 (= K8), K9 (= K9), R10 (= R10), K15 (= K15), K20 (= K20), R21 (= R21), A24 (= A24), Y25 (= Y25), S27 (= S27), H28 (= H28), L29 (= L29), A30 (= A30), P31 (= P31), H32 (= H32), K36 (= K36), Q37 (= Q37), K38 (= K38), R39 (= R39), H40 (= H40), R42 (= R42), K43 (= K43), Q44 (= Q44), S48 (= S48), S50 (= S50), D51 (= D51), R54 (= R54)
8buu3 50S ribosomal protein L13 (see paper)
58% identity, 100% coverage: 1:59/59 of query aligns to 3:61/65 of 8buu3
- binding : M3 (= M1), K4 (= K2), T5 (≠ V3), H6 (≠ K4), R7 (≠ S5), K11 (= K9), R12 (= R10), K14 (= K12), T16 (= T14), G17 (≠ K15), S18 (= S16), K20 (≠ Q18), K22 (= K20), R23 (= R21), H25 (= H23), A26 (= A24), Y27 (= Y25), S29 (= S27), H30 (= H28), L31 (= L29), F32 (≠ A30), A33 (≠ P31), N34 (≠ H32), Q37 (≠ T35), K38 (= K36), Q39 (= Q37), K40 (= K38), R41 (= R39), K42 (≠ H40), R44 (= R42), K45 (= K43), S50 (= S48), G52 (≠ S50), D53 (= D51), K55 (= K53), R56 (= R54), Q59 (≠ N57)
Sites not aligning to the query:
8uu97 Large ribosomal subunit protein bL35 (see paper)
53% identity, 100% coverage: 1:59/59 of query aligns to 3:61/65 of 8uu97
- binding : M3 (= M1), K4 (= K2), T5 (≠ V3), H6 (≠ K4), R7 (≠ S5), K11 (= K9), R12 (= R10), K14 (= K12), T16 (= T14), S18 (= S16), R23 (= R21), G26 (≠ A24), F27 (≠ Y25), S29 (= S27), H30 (= H28), F32 (≠ A30), A33 (≠ P31), N34 (≠ H32), Q37 (≠ T35), K38 (= K36), Q39 (= Q37), R41 (= R39), K42 (≠ H40), R44 (= R42), K45 (= K43), D53 (= D51), R56 (= R54), Q59 (≠ N57)
Sites not aligning to the query:
8p2f8 50S ribosomal protein L35 (see paper)
56% identity, 100% coverage: 1:59/59 of query aligns to 3:61/64 of 8p2f8
- binding magnesium ion: T28 (= T26), F32 (≠ A30)
- binding : M3 (= M1), K4 (= K2), T5 (≠ V3), H6 (≠ K4), R7 (≠ S5), K11 (= K9), R12 (= R10), T16 (= T14), A17 (≠ K15), S18 (= S16), K22 (= K20), R23 (= R21), R25 (≠ H23), A26 (= A24), F27 (≠ Y25), S29 (= S27), H30 (= H28), L31 (= L29), F32 (≠ A30), A33 (≠ P31), N34 (≠ H32), T37 (= T35), K38 (= K36), Q39 (= Q37), K40 (= K38), R41 (= R39), Q42 (≠ H40), R44 (= R42), K45 (= K43), S50 (= S48), S52 (= S50), D53 (= D51), K55 (= K53), R56 (= R54), Q59 (≠ N57)
Sites not aligning to the query:
5ngmA3 structure of the 70S ribosome composing the S. aureus 100S complex (see paper)
56% identity, 100% coverage: 1:59/59 of query aligns to 3:61/64 of 5ngmA3
- binding : M3 (= M1), K4 (= K2), T5 (≠ V3), H6 (≠ K4), R7 (≠ S5), K11 (= K9), R12 (= R10), K14 (= K12), T16 (= T14), A17 (≠ K15), K22 (= K20), R23 (= R21), A26 (= A24), F27 (≠ Y25), T28 (= T26), S29 (= S27), H30 (= H28), F32 (≠ A30), N34 (≠ H32), K38 (= K36), R41 (= R39), Q42 (≠ H40), R44 (= R42), K45 (= K43), S50 (= S48), K51 (≠ A49), S52 (= S50), D53 (= D51), R56 (= R54), Q59 (≠ N57)
Sites not aligning to the query:
5myjB7 of 70S ribosome from Lactococcus lactis (see paper)
52% identity, 92% coverage: 6:59/59 of query aligns to 8:61/64 of 5myjB7
- binding : A8 (= A6), T16 (= T14), N18 (≠ S16), R23 (= R21), R25 (≠ H23), A26 (= A24), Y27 (= Y25), S29 (= S27), H30 (= H28), R31 (≠ L29), F32 (≠ A30), H33 (≠ P31), G34 (≠ H32), K35 (= K33), K38 (= K36), Q39 (= Q37), R40 (≠ K38), R41 (= R39), R44 (= R42), M48 (≠ T46), D53 (= D51), R56 (= R54), R59 (≠ N57)
Sites not aligning to the query:
8cd15 phikz014 (see paper)
49% identity, 93% coverage: 1:55/59 of query aligns to 3:56/63 of 8cd15
- binding : M3 (= M1), K4 (= K2), T5 (≠ V3), K6 (= K4), S7 (= S5), K11 (= K9), R12 (= R10), T16 (= T14), H24 (= H23), A25 (= A24), F26 (≠ Y25), K27 (≠ T26), S28 (= S27), H29 (= H28), L31 (≠ A30), T32 (≠ P31), K33 (≠ H32), T36 (= T35), R38 (≠ Q37), K39 (= K38), R40 (= R39), Q41 (≠ H40), R43 (= R42), K50 (≠ A49), S51 (= S50), R55 (= R54)
Sites not aligning to the query:
7unu7 50S ribosomal protein L35
49% identity, 93% coverage: 1:55/59 of query aligns to 3:56/63 of 7unu7
- binding magnesium ion: F26 (≠ Y25), H29 (= H28)
- binding : M3 (= M1), K4 (= K2), T5 (≠ V3), S7 (= S5), K11 (= K9), R12 (= R10), A17 (≠ S16), G18 (= G17), K21 (= K20), H24 (= H23), A25 (= A24), F26 (≠ Y25), S28 (= S27), H29 (= H28), L31 (≠ A30), T32 (≠ P31), K33 (≠ H32), T36 (= T35), K37 (= K36), R38 (≠ Q37), K39 (= K38), R40 (= R39), R43 (= R42), R55 (= R54)
Sites not aligning to the query:
7nhk7 50S ribosomal protein L36 (see paper)
51% identity, 80% coverage: 9:55/59 of query aligns to 11:57/64 of 7nhk7
- binding : K11 (= K9), R12 (= R10), T16 (= T14), G17 (≠ K15), K22 (= K20), R23 (= R21), R25 (≠ H23), A26 (= A24), F27 (≠ Y25), S29 (= S27), H30 (= H28), R31 (≠ L29), F32 (≠ A30), H33 (≠ P31), K37 (≠ T35), K38 (= K36), Q39 (= Q37), R40 (≠ K38), R41 (= R39), R44 (= R42), K45 (= K43), K51 (≠ A49), D53 (= D51), R56 (= R54)
Sites not aligning to the query:
8a3l2 50S ribosomal protein L36 (see paper)
46% identity, 88% coverage: 1:52/59 of query aligns to 3:54/64 of 8a3l2
- binding : I3 (≠ M1), K4 (= K2), T5 (≠ V3), R7 (≠ S5), K11 (= K9), R12 (= R10), T16 (= T14), K18 (≠ S16), K22 (= K20), H25 (= H23), N27 (≠ Y25), R29 (≠ S27), H30 (= H28), I31 (≠ L29), L32 (≠ A30), T33 (≠ P31), K34 (≠ H32), T37 (= T35), K38 (= K36), R39 (≠ Q37), K40 (= K38), R41 (= R39), H42 (= H40), R44 (= R42), K46 (≠ Q44), M48 (≠ T46), S50 (= S48), K51 (≠ A49), D53 (= D51)
Sites not aligning to the query:
4v9pA3 50S ribosomal protein L35 (see paper)
46% identity, 88% coverage: 1:52/59 of query aligns to 3:54/64 of 4v9pA3
- binding magnesium ion: L28 (≠ T26), R29 (≠ S27)
- binding : I3 (≠ M1), K4 (= K2), T5 (≠ V3), R7 (≠ S5), K11 (= K9), R12 (= R10), T16 (= T14), G17 (≠ K15), K18 (≠ S16), K22 (= K20), H25 (= H23), A26 (= A24), N27 (≠ Y25), R29 (≠ S27), H30 (= H28), I31 (≠ L29), L32 (≠ A30), T33 (≠ P31), K34 (≠ H32), T37 (= T35), K38 (= K36), R39 (≠ Q37), K40 (= K38), R41 (= R39), H42 (= H40), R44 (= R42), K46 (≠ Q44), S50 (= S48), K51 (≠ A49), D53 (= D51)
Sites not aligning to the query:
7f0d3 Cryo-em structure of mycobacterium tuberculosis 50s ribosome subunit bound with clarithromycin (see paper)
40% identity, 98% coverage: 2:59/59 of query aligns to 4:61/62 of 7f0d3
- binding : K4 (= K2), T5 (≠ V3), H6 (≠ K4), S7 (= S5), G8 (≠ A6), K11 (= K9), R12 (= R10), T16 (= T14), G17 (≠ K15), T18 (≠ S16), K20 (≠ Q18), R23 (= R21), A26 (= A24), N27 (≠ Y25), R29 (≠ S27), H30 (= H28), L31 (= L29), L32 (≠ A30), R39 (≠ Q37), R41 (= R39), R42 (≠ H40), L43 (= L41), R46 (≠ Q44), N52 (≠ S50), K55 (= K53), R56 (= R54)
Sites not aligning to the query:
Query Sequence
>59 a.a. (MKVKSAAKKR...)
MKVKSAAKKRFKLTKSGQIKRKHAYTSHLAPHKTTKQKRHLRKQGTVSASDFKRIGNLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory