Comparing 6003772_60_269 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
Q09165 Mesocentin from Caenorhabditis elegans (see 2 papers)
37% identity, 37% coverage: 59:136/210 of query aligns to 11628:11712/13100 of Q09165
Sites not aligning to the query:
>6003772_60_269
WTFGEEGQLKISGRGFGYLATKADYKDYHLVIEYKFPGPTMGSRENKARDNGVLVHGHGP
EGSVGGTWLASIEAQIIEGGTGDILVLPGKTEDGTPVPTTMTGEFVKDRDGELVWQRGSE
KLPMGTDGKPKRLNWAKRDPDWADKAGFYGKNDVQSKFHEWTRMEVVAEGDKLTYYVNGV
EVNEALECKPAEGRICLQTEGAEMLVRRFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory