Comparing 6254960_116_292 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4qhzC Crystal structure of a putative glycosyl hydrolase (bdi_3914) from parabacteroides distasonis atcc 8503 at 2.13 a resolution
31% identity, 82% coverage: 4:149/177 of query aligns to 46:165/240 of 4qhzC
Sites not aligning to the query:
>6254960_116_292
GWKLLFDGRSLGGWHLYQQKGEPKTGWHVEQGVLICPKTNGRPNGSGGDLVTDTKFVDFE
FSFEWRISPAGNSGVLYLFDESRAPGGPPMYRGDTGHSPLGFEYQVLDNENHPDGKRGPT
HRAGALYDLNANDKAAPKPVGEWNESRIVLRGKHIEHWLNGVKSAEADLDSAAYREA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory