Comparing 642684137 IMG__ChlphaBS1_FD:642684137 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
38% identity, 95% coverage: 1:207/217 of query aligns to 1:199/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
36% identity, 95% coverage: 1:207/217 of query aligns to 1:188/194 of 1lbmA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
30% identity, 90% coverage: 5:199/217 of query aligns to 258:438/452 of 1piiA
Sites not aligning to the query:
>642684137 IMG__ChlphaBS1_FD:642684137
MTKIKICGITNPDDAIASCTAGADALGFNFSKASPRYIQPETALSIIEKLPPFISCVGVF
VEQEPHEVNQICNLCRLDHAQLHAERYTAEKAVAVRGAKVIRVFRTGPDFTIDVVRTFAE
ETGITSFLFDAYRPGQPGGTGHVIEQQLAQKIFRETEHIGFGILAGGLKPENVAEATSTV
RPYAVDTASGVEESPGRKNHQKIRDFVSAVHRSAELL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory