SitesBLAST

Comparing 67 a.a. (MEVNKESLVA...) to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found no hits to proteins with known functional sites (download)

Query Sequence

>67 a.a. (MEVNKESLVA...)
MEVNKESLVADELHRMFLAGELQITVEEDINNISERLRNGDLSLDRLSGEDVFIKETVNE
ALRRVEQ

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.