Comparing 6935814 Sama_0032 multifunctional fatty acid oxidation complex subunit alpha (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
61% identity, 100% coverage: 1:714/716 of query aligns to 1:715/719 of 6tnmA
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
61% identity, 100% coverage: 1:714/716 of query aligns to 1:715/729 of P21177
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
61% identity, 100% coverage: 1:713/716 of query aligns to 1:714/715 of 1wdlA
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
61% identity, 100% coverage: 1:713/716 of query aligns to 1:714/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
60% identity, 100% coverage: 1:713/716 of query aligns to 1:706/707 of 1wdmA
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
35% identity, 94% coverage: 17:689/716 of query aligns to 49:736/763 of P40939
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
35% identity, 99% coverage: 7:713/716 of query aligns to 5:703/707 of 6yswA
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
34% identity, 96% coverage: 7:690/716 of query aligns to 3:696/711 of 7o4uA
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
34% identity, 96% coverage: 7:690/716 of query aligns to 12:712/726 of 8oqvA
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
34% identity, 96% coverage: 7:690/716 of query aligns to 13:713/727 of 8oqoA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
34% identity, 96% coverage: 7:690/716 of query aligns to 14:714/728 of 8oqrA
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
34% identity, 96% coverage: 7:690/716 of query aligns to 14:714/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
34% identity, 96% coverage: 7:690/716 of query aligns to 15:715/730 of 8oquA
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
34% identity, 96% coverage: 7:690/716 of query aligns to 14:714/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
34% identity, 96% coverage: 7:690/716 of query aligns to 14:714/729 of 8oqnA
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
34% identity, 96% coverage: 7:690/716 of query aligns to 14:714/729 of 8opvA
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
34% identity, 96% coverage: 7:690/716 of query aligns to 14:714/729 of 8opuA
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
34% identity, 96% coverage: 7:690/716 of query aligns to 8:708/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
34% identity, 96% coverage: 7:690/716 of query aligns to 8:708/723 of 8oqpA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
34% identity, 96% coverage: 7:690/716 of query aligns to 13:713/728 of 8oqlA
>6935814 Sama_0032 multifunctional fatty acid oxidation complex subunit alpha (RefSeq)
MIYQSPTIQVELTADKIARLCFNAPGSVNKFDRETLASLNAALDVLKDSDAKAAVLTSGK
DTFIVGADITEFLALFAEEDAKLMEWIAQANVVFNKLEDLPFPTVSAIKGFALGGGCEAI
LATDFRVADTSAKIGLPETKLGLIPGFGGTVRLPRLIGADNALEWITTGKDQRPEDALKV
GAIDAVVAPENLEAAAIQMLNDALAGKLDWQARRARKQAPLTLPKLEAMMSFTTAKGMVY
AVAGKHYPAPMAAVSVVEQAAGMSRAEALVVEHNAFIKLAKTDVATALIGIFLNDQLVKG
KAKKASKLAKDIKHAAVLGAGIMGGGIAYQSASKGTPIVMKDINQAALDLGVNEAAKLLS
AQVARGRSTPDKMAKVLNNITPALDYAPLKDVNVVVEAVVENPKVKAMVLADVENVVADD
AIIASNTSTISIDLLAKSLKNPARFCGMHFFNPVHKMPLVEVIRGKDTSEETVASVVAYA
SKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLADGGDFAAIDKVMEKQFGWPMGPAYLL
DVVGLDTGHHAQAVMADGFPDRMGKSDKDAIDVMYEAGRLGQKNGKGFYQYSIDKRGKPK
KDVDPASYTMLAEAFGAQKAFEADEIIARTMIPMIIETVRCLEEGIVASPAEADMGLVYG
LGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRELASNNGSYYPKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory