SitesBLAST
Comparing 6935941 FitnessBrowser__SB2B:6935941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6m77A Gh31 alpha-n-acetylgalactosaminidase from enterococcus faecalis in complex with n-acetylgalactosamine (see paper)
35% identity, 62% coverage: 40:724/1108 of query aligns to 2:750/907 of 6m77A
7f7rA Enterococcus faecalis gh31 alpha-n-acetylgalactosaminidase d455n in complex with tn antigen (see paper)
35% identity, 62% coverage: 40:724/1108 of query aligns to 2:750/899 of 7f7rA
7f7qA Enterococcus faecalis gh31 alpha-n-acetylgalactosaminidase d455a in complex with p-nitrophenyl alpha-n-acetylgalactosaminide (see paper)
35% identity, 62% coverage: 40:724/1108 of query aligns to 2:750/898 of 7f7qA
6jr7A Flavobacterium johnsoniae gh31 dextranase, fjdex31a, complexed with glucose (see paper)
25% identity, 66% coverage: 40:773/1108 of query aligns to 4:811/812 of 6jr7A
- binding alpha-D-glucopyranose: G249 (vs. gap), D277 (vs. gap), W352 (= W324), W352 (= W324), W386 (= W355), D388 (vs. gap), R445 (≠ V413), D461 (= D429), Y500 (≠ I462), H530 (≠ M486), G533 (≠ W489)
5x7sA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase, terbium derivative (see paper)
25% identity, 66% coverage: 52:785/1108 of query aligns to 20:831/1247 of 5x7sA
Sites not aligning to the query:
- binding calcium ion: 846, 849, 945, 961, 979, 982, 1077, 1100, 1102, 1139, 1142, 1239
- binding terbium(iii) ion: 1149
5x7qA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase complexed with maltohexaose (see paper)
25% identity, 66% coverage: 52:785/1108 of query aligns to 20:831/1247 of 5x7qA
- binding beta-D-glucopyranose: W250 (vs. gap), D277 (vs. gap), Y278 (vs. gap), K322 (vs. gap), R328 (≠ P305), R334 (≠ V311), D395 (= D358), E396 (≠ G359), R440 (≠ G415), D457 (= D429), F499 (≠ V459), H531 (≠ M486)
- binding calcium ion: E821 (= E775), E823 (≠ D777)
- binding alpha-D-glucopyranose: Y184 (vs. gap), Y184 (vs. gap), Y186 (vs. gap), Y186 (vs. gap), D188 (≠ W218), K192 (≠ S222), K192 (≠ S222), E194 (≠ D224), Y196 (≠ R226), Y196 (≠ R226), G198 (≠ S228)
- binding magnesium ion: E249 (vs. gap), G251 (vs. gap)
Sites not aligning to the query:
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: 1114, 1155, 1157, 1188, 1227
- binding beta-D-glucopyranose: 1132
- binding calcium ion: 846, 849, 945, 961, 979, 982, 1077, 1100, 1102, 1139, 1142, 1239
- binding alpha-D-glucopyranose: 842, 853, 855, 855, 909, 943, 975, 975, 976, 1042, 1043, 1044, 1073, 1075, 1108, 1126, 1135, 1143, 1145, 1147, 1179, 1233, 1235, 1237
5x7pA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase complexed with acarbose (see paper)
25% identity, 66% coverage: 52:785/1108 of query aligns to 20:831/1247 of 5x7pA
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: W250 (vs. gap), D277 (vs. gap), Y278 (vs. gap), K322 (vs. gap), D395 (= D358), E396 (≠ G359), R440 (≠ G415), D457 (= D429), F499 (≠ V459), H531 (≠ M486)
- binding calcium ion: E821 (= E775), E823 (≠ D777)
- binding alpha-D-glucopyranose: Q140 (≠ G172), Y184 (vs. gap), G198 (≠ S228), G199 (≠ D229), G403 (= G368), S404 (≠ K369), D457 (= D429), N500 (≠ D460)
- binding magnesium ion: E249 (vs. gap), G251 (vs. gap)
Sites not aligning to the query:
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: 842, 909, 943, 1114, 1126, 1135, 1143, 1145, 1155, 1157, 1179, 1186, 1188, 1227, 1235
- binding calcium ion: 846, 849, 945, 961, 979, 982, 1077, 1100, 1102, 1139, 1142, 1239
5x7oA Crystal structure of paenibacillus sp. 598k alpha-1,6- glucosyltransferase (see paper)
25% identity, 66% coverage: 52:785/1108 of query aligns to 20:831/1247 of 5x7oA
Sites not aligning to the query:
- binding calcium ion: 846, 849, 945, 961, 979, 982, 1077, 1100, 1102, 1139, 1142, 1239
5hxmA Cycloalternan-forming enzyme from listeria monocytogenes in complex with panose (see paper)
30% identity, 30% coverage: 415:749/1108 of query aligns to 585:908/1060 of 5hxmA
Sites not aligning to the query:
- binding calcium ion: 939, 941, 958, 961, 1054
- binding alpha-D-glucopyranose: 954, 967, 997, 1020, 1050, 1052
- binding magnesium ion: 370, 372, 376
4kwuA 1.9 angstrom resolution crystal structure of uncharacterized protein lmo2446 from listeria monocytogenes egd-e in complex with alpha-d- glucose, beta-d-glucose, magnesium and calcium
30% identity, 30% coverage: 415:749/1108 of query aligns to 584:907/1059 of 4kwuA
Sites not aligning to the query:
- binding beta-D-glucopyranose: 46, 48, 60, 71, 72, 114, 235, 269, 306, 496, 582
- binding calcium ion: 938, 940, 957, 960, 1053
- binding alpha-D-glucopyranose: 42, 43, 44, 45, 65, 368, 396, 400, 401, 402, 408, 411, 412, 452, 464, 465, 466, 953, 1019, 1051
- binding magnesium ion: 369, 371, 375
Q14697 Neutral alpha-glucosidase AB; Alpha-glucosidase 2; Glucosidase II subunit alpha; EC 3.2.1.207 from Homo sapiens (Human) (see 6 papers)
30% identity, 29% coverage: 388:703/1108 of query aligns to 575:884/944 of Q14697
- R590 (≠ N403) to P: found in a patient with polycystic liver disease; uncertain significance; dbSNP:rs1465649718
- H785 (≠ P603) to N: found in a patient affected by polycystic liver disease; uncertain significance; the patient carried additional PKHD1 variant; the mutation results in significantly reduced alpha-glucosidase activity; dbNP:rs753910059; dbSNP:rs753910059
- R817 (≠ L635) to W: in PKD3; fails to promote PKD1 and PKD2 localization to the cell surface; dbSNP:rs879255643
- H850 (≠ N665) to Y: in dbSNP:rs114915323
Sites not aligning to the query:
- 4:5 natural variant: Missing (in PKD3; uncertain significance; no apparent effect on the endoplasmic reticulum localization; dbSNP:rs750723025)
- 95 Q → R: no effect on PKD1 and PKD2 localization to the cell surface; dbSNP:rs1392032530
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 232 T → A: no effect on PKD1 and PKD2 localization to the cell surface
- 309 R → C: no effect on PKD1 and PKD2 localization to the cell surface; dbSNP:rs1063445
- 383 T → R: in PKD3; fails to promote PKD1 and PKD2 localization to the cell surface; dbSNP:rs879255642
- 400 R → L: in PKD3; fails to promote PKD1 and PKD2 localization to the cell surface; dbSNP:rs770519542
- 542 D→N: Loss of activity.
- 815:944 natural variant: Missing (found in a patient with polycystic liver disease; uncertain significance; no apparent effect on the endoplasmic reticulum localization)
- 864:944 natural variant: Missing (found in a patient with polycystic liver disease; uncertain significance; no apparent effect on the endoplasmic reticulum localization; dbSNP:rs1210158408)
- 918:944 natural variant: Missing (found in a patient affected by polycystic liver disease; uncertain significance)
7kncA Crystal structure of the gh31 alpha-xylosidase (xac1773) from xanthomonas citri
31% identity, 30% coverage: 386:713/1108 of query aligns to 564:886/919 of 7kncA
Sites not aligning to the query:
Q8BHN3 Neutral alpha-glucosidase AB; Alpha-glucosidase 2; Glucosidase II subunit alpha; EC 3.2.1.207 from Mus musculus (Mouse) (see 3 papers)
30% identity, 26% coverage: 388:680/1108 of query aligns to 575:866/944 of Q8BHN3
- D618 (= D429) active site, Proton donor; mutation to N: Loss of enzyme activity.
- C633 (≠ L444) modified: Disulfide link with 644
- C644 (≠ A455) modified: Disulfide link with 633
- R818 (≠ Y636) mutation to E: Disrupts interaction with PRKCSH. Nearly abolishes enzyme activity.
Sites not aligning to the query:
- 1:32 signal peptide
- 41 modified: Disulfide link with 47
- 47 modified: Disulfide link with 41
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 542 active site, Nucleophile; mutation D->E,N: Loss of enzyme activity.
5jovA Bacteroides ovatus xyloglucan pul gh31 with bound 5fidof (see paper)
29% identity, 31% coverage: 388:729/1108 of query aligns to 582:934/949 of 5jovA
Sites not aligning to the query:
5iegA Murine endoplasmic reticulum alpha-glucosidase ii with n-9'- methoxynonyl-1-deoxynojirimycin (see paper)
30% identity, 26% coverage: 388:680/1108 of query aligns to 485:776/856 of 5iegA
Sites not aligning to the query:
7kryA Co-crystal structure of alpha glucosidase with compound 11 (see paper)
30% identity, 26% coverage: 388:680/1108 of query aligns to 485:776/854 of 7kryA
Sites not aligning to the query:
- binding (1S,2S,3R,4S,5S)-5-({6-[(4-azido-2-nitrophenyl)amino]hexyl}amino)-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: 214, 311, 339, 340, 411, 412, 413, 450, 452, 459
7kb8A Co-crystal structure of alpha glucosidase with compound 8 (see paper)
30% identity, 26% coverage: 388:680/1108 of query aligns to 485:776/854 of 7kb8A
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(4-{[2-nitro-4-(triazan-1-yl)phenyl]amino}butyl)amino]cyclohexane-1,2,3,4-tetrol: R512 (≠ V413), D528 (= D429), F561 (≠ I462), H586 (≠ M486)
Sites not aligning to the query:
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(4-{[2-nitro-4-(triazan-1-yl)phenyl]amino}butyl)amino]cyclohexane-1,2,3,4-tetrol: 214, 311, 339, 340, 413, 450, 452, 459
7kadA Co-crystal structure of alpha glucosidase with compound 6 (see paper)
30% identity, 26% coverage: 388:680/1108 of query aligns to 485:776/854 of 7kadA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(6-{[2-nitro-4-(1H-1,2,3-triazol-1-yl)phenyl]amino}hexyl)amino]cyclohexane-1,2,3,4-tetrol: D528 (= D429), F561 (≠ I462), H586 (≠ M486)
Sites not aligning to the query:
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(6-{[2-nitro-4-(1H-1,2,3-triazol-1-yl)phenyl]amino}hexyl)amino]cyclohexane-1,2,3,4-tetrol: 214, 311, 339, 340, 413, 450, 452, 459
7k9oA Co-crystal structure of alpha glucosidase with compound 3 (see paper)
30% identity, 26% coverage: 388:680/1108 of query aligns to 485:776/854 of 7k9oA
- binding (1~{S},2~{S},3~{R},4~{S},5~{S})-1-(hydroxymethyl)-5-[6-[[2-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]-4-(1,2,3,4-tetrazol-1-yl)phenyl]amino]hexylamino]cyclohexane-1,2,3,4-tetrol: R512 (≠ V413), D528 (= D429), F561 (≠ I462), H586 (≠ M486)
Sites not aligning to the query:
- binding (1~{S},2~{S},3~{R},4~{S},5~{S})-1-(hydroxymethyl)-5-[6-[[2-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]-4-(1,2,3,4-tetrazol-1-yl)phenyl]amino]hexylamino]cyclohexane-1,2,3,4-tetrol: 214, 311, 339, 340, 413, 450, 452, 453, 459
5iefA Murine endoplasmic reticulum alpha-glucosidase ii with n-butyl-1- deoxynojirimycin (see paper)
30% identity, 26% coverage: 388:680/1108 of query aligns to 488:779/858 of 5iefA
Sites not aligning to the query:
Query Sequence
>6935941 FitnessBrowser__SB2B:6935941
MASLSPSFSPWRSRARLSPLALAVALVIAPIGFTANAAPVGKLDTLRQEGASVDIRTDSG
ALVQVSVLKPSLIRIQAGANGKLTAEGSKAAAIVIKDDYPAVAYTLSDEGDYRLLKTEAL
ALRIYEAPLRFALYQADNQTLITEELQSLELGESSTVQTLSTDVDERFFGGGQQNGAFEF
KGKSLEISYSGGWEEGDRPSPAPFYLSSKGYGVLRNTWANGSYDFRSSDALRLGHDEARF
DAFFFAPGSIQQVLADYTELTGRARLIPRWAFEYGDADCYNDGDNVKKPGTVPDGWSDGP
TGTTPDVIDSVAKKYREHDMPGGWILPNDGYGCGYTDLPKVVEGLAKYGFRTGLWTEDGV
DKIAWEVGKAGTRAQKLDVAWTGEGYQHALDANKAAADGILDNSDSRPFLWTVMGWAGMQ
RYAVTWTGDQSGSWDYIRWHIPTLIGSGLSGQAYATGDVDAIFGGSPETFTRDLQWKAFT
PVLMGMSGWSKAARKHPWWFDEPYRSINRDYLKLKMRLTPYMYTTAFETEQTGAPIVRGL
MWDYNDDPNANTEAHKYQFLLGKDMLVAPVYRSQTASKGWREDVYLPKGQWIDYWDGRVV
DAPEGGASIDYQVDLNTIPVFVRAGAIIPMYPEALYDGHKPKDVLTLDIYPYGESEYLMY
EDDGNTRRYQQGEFARQLFAVKAHEGKAGDIEVSIGAAEGKFDGQDEERVYELWLHTRTK
PDSVLLNGKKLKALKDEAALAKAKSGWTYSDTKYGTVLVKVAKTSVREALEIKLEIDDAK
VLAATAGYSVAPELGNEIPADSLLVLGRPAEESGHPLENAFDGNPDTWFRTKRDQAQKTG
AHEFTLALGERRFIAGFEIAPRNDKHWEYGQVADYEVYLGENNGEWGEPVAKGRLEKSQT
MQKVEFAPKPGSLLRFRILSTQNELGSDPMVTAAKGQGGAFNALLPKSVTPITISEFKVL
TAPEPKAPKTQLFLAEMTPQKLDKSAGSRVALNSAIGGKPMSMNGLKFSKGLGMAANGRV
DYRLEGNWQLLRADLGIDDSCKTKGGLHFKIFGDGKLMYDSGLIEAPAVVKPELDIRGVE
ILSLQTEGTAKGVCGNWANASVVGWPKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory