Comparing 6936040 FitnessBrowser__SB2B:6936040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7f03A CytochromE C-type biogenesis protein ccmabcd from e. Coli in complex with anp (see paper)
49% identity, 93% coverage: 11:212/217 of query aligns to 3:201/202 of 7f03A
8ce5a CytochromE C maturation complex ccmabcd, e154q, atp-bound (see paper)
48% identity, 93% coverage: 11:212/217 of query aligns to 3:201/203 of 8ce5a
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
31% identity, 75% coverage: 9:171/217 of query aligns to 2:173/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
31% identity, 75% coverage: 9:171/217 of query aligns to 2:173/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
31% identity, 75% coverage: 10:171/217 of query aligns to 1:171/253 of 6z5uK
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
29% identity, 85% coverage: 29:213/217 of query aligns to 20:211/222 of 8i6rB
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 81% coverage: 30:204/217 of query aligns to 20:201/240 of 4ymuJ
Sites not aligning to the query:
Q8N139 ATP-binding cassette sub-family A member 6; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
32% identity, 87% coverage: 9:196/217 of query aligns to 1283:1471/1617 of Q8N139
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
26% identity, 81% coverage: 22:197/217 of query aligns to 18:202/226 of 5xu1B
P0A9W3 Energy-dependent translational throttle protein EttA; Translational regulatory factor EttA; EC 3.6.1.- from Escherichia coli (strain K12) (see 4 papers)
28% identity, 80% coverage: 23:196/217 of query aligns to 335:499/555 of P0A9W3
Sites not aligning to the query:
3j5sD Etta binds to ribosome exit site and regulates translation by restricting ribosome and tRNA dynamics (see paper)
28% identity, 80% coverage: 23:196/217 of query aligns to 334:498/554 of 3j5sD
Sites not aligning to the query:
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
29% identity, 87% coverage: 12:199/217 of query aligns to 4:200/262 of 7chaI
A0A0H2VFI8 Energy-dependent translational throttle protein EttA; Translational regulatory factor EttA; EC 3.6.1.- from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (see paper)
28% identity, 80% coverage: 23:196/217 of query aligns to 335:499/555 of A0A0H2VFI8
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 78% coverage: 27:196/217 of query aligns to 16:186/348 of 3d31A
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
27% identity, 86% coverage: 12:197/217 of query aligns to 3:195/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
27% identity, 86% coverage: 12:197/217 of query aligns to 3:195/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
27% identity, 86% coverage: 10:196/217 of query aligns to 1:194/233 of 6b8bA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
27% identity, 86% coverage: 12:197/217 of query aligns to 3:195/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 87% coverage: 10:197/217 of query aligns to 1:195/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 87% coverage: 10:197/217 of query aligns to 1:195/238 of 6s8gA
>6936040 FitnessBrowser__SB2B:6936040
MTLPTKTAHSLVSAEKLTCIREERILFDELSFSVNEGDIIQIEGPNGAGKTSLLRILAGL
SRPYAGSVFYRDEEIGRCRDEFNEDLLYLGHLAGVKSELTAEENLNFNLRLSGYDDFDTG
EVLAKVNLKGFEEALAGHLSAGQHRRTALARLWHSNCKVWILDEPFTAIDKRGVAELEQL
FLKHADNGGCVILTTHQDMGLIKDERLRKLKLEYRFV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory