Comparing 6936058 FitnessBrowser__SB2B:6936058 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
57% identity, 99% coverage: 4:381/383 of query aligns to 2:378/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
29% identity, 78% coverage: 79:378/383 of query aligns to 72:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
29% identity, 78% coverage: 79:378/383 of query aligns to 73:358/360 of 2f7vA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 85% coverage: 53:377/383 of query aligns to 46:378/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 94% coverage: 25:383/383 of query aligns to 16:377/377 of 7t1qA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
29% identity, 62% coverage: 14:252/383 of query aligns to 12:246/377 of P44514
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
29% identity, 62% coverage: 14:252/383 of query aligns to 16:250/380 of 5vo3A
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
24% identity, 90% coverage: 23:366/383 of query aligns to 14:360/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
24% identity, 90% coverage: 23:366/383 of query aligns to 14:360/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
27% identity, 60% coverage: 24:252/383 of query aligns to 17:247/377 of 7lgpB
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 69% coverage: 20:282/383 of query aligns to 22:295/408 of Q03154
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
27% identity, 69% coverage: 20:282/383 of query aligns to 22:294/407 of P37111
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 42% coverage: 14:173/383 of query aligns to 14:170/258 of 4h2kA
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
24% identity, 82% coverage: 62:374/383 of query aligns to 45:331/341 of 5xoyA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 51% coverage: 74:267/383 of query aligns to 99:297/426 of 3pfoA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 37% coverage: 75:215/383 of query aligns to 121:278/503 of Q8C165
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
28% identity, 38% coverage: 20:163/383 of query aligns to 16:158/192 of 1q7lA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
45% identity, 14% coverage: 63:114/383 of query aligns to 83:137/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
45% identity, 14% coverage: 63:114/383 of query aligns to 114:168/507 of Q96KN2
Sites not aligning to the query:
>6936058 FitnessBrowser__SB2B:6936058
MKVIPDLKSRFSSLIYAPSISATEPQLDMSNHSVIALLNDWFSDLGFDCQVTKVAGTRDK
RNLLAKIGSGEGGLLLAGHTDTVPFDEGRWSQDPFVLTEKDDRWYGLGSCDMKGFFALIL
EAAKDLPLHNLQKPLYIFASADEETTMEGAKAFAANTGIRPEYAIIGEPTGLKPVYMHKG
HLAQGIRITGRSGHSSDPARGLNAIEIMHKVIGQLLKLKQHLADNYREDAFSVPYPTMNF
GHIHGGDAANRICGCCDLHLDIRPLPGLALEDLELMLVNYLQDITRDYPGSVDIRTLYPG
SEAFAGVKDSAWTQLVESLSGQQAEVVNYATEAPYINKLGCQTLVLGPGSINQAHQPDEY
MAMDQLKPTVELLKQLIHKACIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory