Comparing 6936093 FitnessBrowser__SB2B:6936093 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
28% identity, 98% coverage: 8:394/395 of query aligns to 12:399/413 of P32140
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
28% identity, 98% coverage: 8:394/395 of query aligns to 24:411/425 of 7ag4D
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
28% identity, 98% coverage: 8:394/395 of query aligns to 12:399/416 of 2zblA
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
23% identity, 95% coverage: 15:389/395 of query aligns to 20:416/423 of 8h1lB
P0DKY4 Cellobiose 2-epimerase; CE; EC 5.1.3.11 from Ruminococcus albus (see paper)
21% identity, 95% coverage: 11:386/395 of query aligns to 9:383/389 of P0DKY4
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
23% identity, 96% coverage: 11:391/395 of query aligns to 20:402/407 of 3wkiA
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
23% identity, 96% coverage: 11:391/395 of query aligns to 20:402/410 of 3wkhA
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
23% identity, 96% coverage: 11:391/395 of query aligns to 20:402/410 of 3wkgA
7d5gA Crystal structure of the csce with ligand to have a insight into the catalytic mechanism
20% identity, 95% coverage: 14:387/395 of query aligns to 16:387/389 of 7d5gA
P51606 N-acylglucosamine 2-epimerase; AGE; GlcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; Renin-binding protein; RnBP; EC 5.1.3.8 from Homo sapiens (Human) (see paper)
28% identity, 37% coverage: 245:389/395 of query aligns to 256:407/427 of P51606
Sites not aligning to the query:
P17560 N-acylglucosamine 2-epimerase; AGE; GlcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; Renin-binding protein; RnBP; EC 5.1.3.8 from Sus scrofa (Pig) (see paper)
27% identity, 37% coverage: 245:389/395 of query aligns to 246:397/402 of P17560
Sites not aligning to the query:
>6936093 FitnessBrowser__SB2B:6936093
MNFFSQTFLLEHCQSILDFYTDRVVDPSGGYHQNFLDDGSLFDTHFKQLVSSTRILVNYA
TAGILFGRQDYLDIARHGLDYLEEVHWQASSQTYAWTLDNHKPLDMTQQAYGYAFVLLAY
AAARKADLVQDDSKLQQVYDLLEQRFWQAEYGLYADEISPEGVLSPYRGQNANMHLCEAM
LAAFEATGNNQYLERASQLAQSIAVRQASLTNDLVWEHYTPEFKPDWDYNRDDPKNLYRP
WGFQPGHQTEWAKLLLILNRHAPQAWQIERAASLFDRAYQQAWDNQDGGLVYGFDPEGNW
CDDDKYFWVQAESFAAAAMLHKATGDDKYLTQYDALWQYSWAHMVDHEYGAWFRVLRKDN
SKYSNQKSAAGAKCDYHTLGACFEVLRVLGHPALK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory