Comparing 6936101 FitnessBrowser__SB2B:6936101 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2e2oA Crystal structure of sulfolobus tokodaii hexokinase in complex with glucose (see paper)
28% identity, 85% coverage: 40:316/327 of query aligns to 5:287/299 of 2e2oA
2e2pA Crystal structure of sulfolobus tokodaii hexokinase in complex with adp (see paper)
28% identity, 85% coverage: 40:316/327 of query aligns to 5:287/298 of 2e2pA
2e2qA Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp (see paper)
28% identity, 85% coverage: 40:316/327 of query aligns to 5:287/297 of 2e2qA
>6936101 FitnessBrowser__SB2B:6936101
MAACAAVHHDTQATQTGAAYAPAEQGGEPRESSASAYFWVGIDAGGSHCRALLTDDSGQV
LGHGVAGPANPVNGVSQSQAAIMSAIDKALGAARLDKQYHRLIVGAGLAGLHLPKMQQVM
NEWAHPFAAWHTTTDLHVAALGAHQGADGGVIILGTGFSSLANVKGQQILIGGHGFPINA
TCSGSWFGLEAVKAVLLDADGIGPGTSLTGKLLQGTNAMALAEQLMHANATDFARFAPQV
FEQAGAGDAVSLSLIEQGATFINGVIRRLLATGIDSLSLVGGIAPLMQPWLAPDLSTRIR
TAKASPEEGAILFARQCHVGNSRIQER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory