SitesBLAST
Comparing 6936200 FitnessBrowser__SB2B:6936200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A140FAN3 11-beta-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase; Steroleosin; EC 1.1.1.146; EC 1.1.1.62 from Pinus massoniana (Chinese red pine) (see paper)
34% identity, 94% coverage: 7:259/270 of query aligns to 48:303/356 of A0A140FAN3
Sites not aligning to the query:
- 206:356 mutation Missing: Loss of binding to plant derived cholesterol, cholest-5-en-3beta-ol.
3gmdA Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i (see paper)
38% identity, 67% coverage: 4:185/270 of query aligns to 7:185/264 of 3gmdA
- active site: S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding 2-methyl-3-{(3S)-1-[(1-pyridin-2-ylcyclopropyl)carbonyl]pyrrolidin-3-yl}-1H-pyrrolo[2,3-b]pyridine: T99 (= T97), S145 (= S145), Y152 (≠ V152), Y158 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), K19 (≠ E16), G20 (= G17), I21 (= I18), R41 (= R38), S42 (= S39), T67 (≠ S64), M68 (vs. gap), N94 (= N92), H95 (≠ N93), I96 (≠ A94), V117 (= V117), I143 (= I143), S145 (= S145), Y158 (= Y158), K162 (= K162)
Sites not aligning to the query:
4nmhA 11-beta-hsd1 in complex with a 3,3-di-methyl-azetidin-2-one
38% identity, 67% coverage: 4:185/270 of query aligns to 8:186/265 of 4nmhA
- active site: S101 (≠ M98), H106 (≠ D103), Q136 (≠ H135), S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding (4S)-4-(2-methoxyphenyl)-3,3-dimethyl-1-[3-(methylsulfonyl)phenyl]azetidin-2-one: I97 (≠ A94), S146 (= S145), Y153 (≠ V152), Y159 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G17 (= G13), S19 (= S15), K20 (≠ E16), I22 (= I18), A41 (= A37), R42 (= R38), S43 (= S39), M69 (vs. gap), N95 (= N92), I97 (≠ A94), I144 (= I143), S146 (= S145), Y159 (= Y158), K163 (= K162)
Sites not aligning to the query:
5qijA Crystal structure of murine 11b- hydroxysteroiddehydrogenase complexed with 2-(3-(1-(4- chlorophenyl)cyclopropyl)-[1,2,4]triazolo[4,3- a]pyridin-8- yl)propan-2-ol (see paper)
38% identity, 67% coverage: 4:185/270 of query aligns to 8:186/265 of 5qijA
- active site: S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding 2-{3-[1-(4-chlorophenyl)cyclopropyl][1,2,4]triazolo[4,3-a]pyridin-8-yl}propan-2-ol: T100 (= T97), S101 (≠ M98), L102 (≠ W99), L147 (≠ V146), L147 (≠ V146), A148 (= A147), Q153 (≠ V152), Q153 (≠ V152), I156 (≠ R155), Y159 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G13), S19 (= S15), G21 (= G17), I22 (= I18), R42 (= R38), S43 (= S39), T68 (≠ S64), M69 (vs. gap), N95 (= N92), H96 (≠ N93), I97 (≠ A94), I144 (= I143), S146 (= S145), Y159 (= Y158), K163 (= K162)
Sites not aligning to the query:
- binding 2-{3-[1-(4-chlorophenyl)cyclopropyl][1,2,4]triazolo[4,3-a]pyridin-8-yl}propan-2-ol: 193, 199, 202, 235, 237, 252, 255, 256, 259
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 191, 192, 194, 196, 198, 199
5pgzA Crystal structure of murine 11beta- hydroxysteroiddehydrogenase complexed with 2-[(5r,7s)-6-hydroxy-2-phenyladamantan-2-yl]-1-(3- hydroxyazetidin-1-yl)ethan-1-one (bms-816336) (see paper)
38% identity, 67% coverage: 4:185/270 of query aligns to 8:186/265 of 5pgzA
- active site: S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding 2-[(5r,7s)-6-hydroxy-2-phenyladamantan-2-yl]-1-(3-hydroxyazetidin-1-yl)ethan-1-one: S146 (= S145), L147 (≠ V146), Q153 (≠ V152), I156 (≠ R155), Y159 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G13), S19 (= S15), K20 (≠ E16), G21 (= G17), I22 (= I18), R42 (= R38), S43 (= S39), T68 (≠ S64), M69 (vs. gap), N95 (= N92), I97 (≠ A94), I144 (= I143), S146 (= S145), Y159 (= Y158), K163 (= K162)
Sites not aligning to the query:
4k26A 4,4-dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 -hsd1 inhibitors for the treatment of diabetes (see paper)
38% identity, 67% coverage: 4:185/270 of query aligns to 8:186/265 of 4k26A
- active site: S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G17 (= G13), S19 (= S15), K20 (≠ E16), G21 (= G17), I22 (= I18), A41 (= A37), R42 (= R38), S43 (= S39), T68 (≠ S64), M69 (vs. gap), N95 (= N92), I97 (≠ A94), I144 (= I143), S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding (4aS,8aR)-N-cyclohexyl-4a,5,6,7,8,8a-hexahydro-4,1,2-benzoxathiazin-3-amine 1,1-dioxide: I97 (≠ A94), S146 (= S145), L147 (≠ V146), A148 (= A147), Q153 (≠ V152), I156 (≠ R155), Y159 (= Y158)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 191, 192, 193, 194, 196, 198, 199
- binding (4aS,8aR)-N-cyclohexyl-4a,5,6,7,8,8a-hexahydro-4,1,2-benzoxathiazin-3-amine 1,1-dioxide: 192, 203
1y5rA The crystal structure of murine 11b-hydroxysteroid dehydrogenase complexed with corticosterone (see paper)
38% identity, 67% coverage: 4:185/270 of query aligns to 8:186/265 of 1y5rA
- active site: S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding corticosterone: I97 (≠ A94), S146 (= S145), Q153 (≠ V152), Y159 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G17 (= G13), S19 (= S15), K20 (≠ E16), G21 (= G17), I22 (= I18), R42 (= R38), S43 (= S39), T68 (≠ S64), M69 (vs. gap), N95 (= N92), I97 (≠ A94), I144 (= I143), S146 (= S145), Y159 (= Y158), K163 (= K162)
Sites not aligning to the query:
3h6kA Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an ortho-chlro-sulfonyl-piperazine inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 7:185/260 of 3h6kA
- active site: S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding 3-chloro-4-({(2R)-4-[4-fluoro-2-(trifluoromethyl)phenyl]-2-methylpiperazin-1-yl}sulfonyl)benzamide: I96 (≠ A94), T99 (= T97), A147 (= A147), Y152 (≠ V152), Y158 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), K19 (≠ E16), G20 (= G17), I21 (= I18), A40 (= A37), R41 (= R38), S42 (= S39), T67 (≠ S64), M68 (vs. gap), N94 (= N92), I96 (≠ A94), V143 (≠ I143), S145 (= S145), Y158 (= Y158), K162 (= K162)
Sites not aligning to the query:
3oq1A Crystal structure of 11beta-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with diarylsulfone inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 12:190/261 of 3oq1A
- active site: S150 (= S145), Y163 (= Y158), K167 (= K162)
- binding 3-(2-fluoroethyl)-4-({4-[(2S)-1,1,1-trifluoro-2-hydroxypropan-2-yl]phenyl}sulfonyl)benzonitrile: L151 (≠ V146), A152 (= A147), Y163 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G13), S23 (= S15), K24 (≠ E16), I26 (= I18), A45 (= A37), R46 (= R38), S47 (= S39), M73 (vs. gap), N99 (= N92), I101 (≠ A94), V148 (≠ I143), S150 (= S145), Y163 (= Y158), K167 (= K162)
Sites not aligning to the query:
4hx5A Crystal structure of 11 beta-hsd1 in complex with sar184841 (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 8:186/261 of 4hx5A
- active site: S146 (= S145), Y159 (= Y158), K163 (= K162)
- binding 4-[5-(4-tert-butylpiperazin-1-yl)pyridin-2-yl]-N-[(1R,2S,3S,5S,7s)-5-carbamoyltricyclo[3.3.1.1~3,7~]dec-2-yl]-3,4-dihydroquinoxaline-1(2H)-carboxamide: I97 (≠ A94), S146 (= S145), L147 (≠ V146), Y153 (≠ V152), Y159 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G17 (= G13), S19 (= S15), G21 (= G17), I22 (= I18), A41 (= A37), R42 (= R38), S43 (= S39), T68 (≠ S64), M69 (vs. gap), N95 (= N92), I97 (≠ A94), V144 (≠ I143), S146 (= S145), Y159 (= Y158), K163 (= K162)
Sites not aligning to the query:
- binding 4-[5-(4-tert-butylpiperazin-1-yl)pyridin-2-yl]-N-[(1R,2S,3S,5S,7s)-5-carbamoyltricyclo[3.3.1.1~3,7~]dec-2-yl]-3,4-dihydroquinoxaline-1(2H)-carboxamide: 192, 193, 198, 202, 209, 237, 240, 256, 260
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 191, 193, 194, 196, 198, 199
4k1lA 4,4-dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 beta- hsd1 inhibitors for the treatment of diabetes (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 12:190/263 of 4k1lA
- active site: S150 (= S145), Y163 (= Y158), K167 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G13), S23 (= S15), K24 (≠ E16), G25 (= G17), I26 (= I18), R46 (= R38), S47 (= S39), T72 (≠ S64), M73 (vs. gap), N99 (= N92), H100 (≠ N93), I101 (≠ A94), V148 (≠ I143), S150 (= S145), Y163 (= Y158), K167 (= K162)
- binding (4aS,8aR)-N-cyclohexyl-4a,5,6,7,8,8a-hexahydro-4,1,2-benzoxathiazin-3-amine 1,1-dioxide: I101 (≠ A94), T104 (= T97), L151 (≠ V146), A152 (= A147), Y157 (≠ V152), Y163 (= Y158)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 195, 196, 198, 200, 202, 203
- binding (4aS,8aR)-N-cyclohexyl-4a,5,6,7,8,8a-hexahydro-4,1,2-benzoxathiazin-3-amine 1,1-dioxide: 196, 207
3d3eA Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with benzamide inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 12:190/262 of 3d3eA
- active site: S150 (= S145), Y163 (= Y158), K167 (= K162)
- binding N-cyclopropyl-N-(trans-4-pyridin-3-ylcyclohexyl)-4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]benzamide: T104 (= T97), L106 (≠ W99), S150 (= S145), L151 (≠ V146), Y157 (≠ V152), M159 (≠ T154), Y163 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G13), S23 (= S15), K24 (≠ E16), G25 (= G17), I26 (= I18), R46 (= R38), S47 (= S39), M73 (vs. gap), N99 (= N92), I101 (≠ A94), V148 (≠ I143), S150 (= S145), Y163 (= Y158), K167 (= K162)
Sites not aligning to the query:
3ch6A Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4- methylphenyl)pyridin-2-yl)methanone (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 7:185/264 of 3ch6A
- active site: S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4-methylphenyl)pyridin-2-yl)methanone: S145 (= S145), Y152 (≠ V152), P153 (= P153), Y158 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), K19 (≠ E16), G20 (= G17), I21 (= I18), R41 (= R38), S42 (= S39), T67 (≠ S64), M68 (vs. gap), N94 (= N92), I96 (≠ A94), V143 (≠ I143), S145 (= S145), Y158 (= Y158), K162 (= K162)
Sites not aligning to the query:
5pgwA Crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 2-[(1r,3s,5r,7s)-2-[4-(4-fluorophenyl)phenyl]-6- hydroxyadamantan-2-yl]-1-(3- hydroxyazetidin-1-yl)ethan-1-one (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 7:185/259 of 5pgwA
- active site: S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding 2-[(1r,3s,5r,7s)-2-[4-(4-fluorophenyl)phenyl]-6-hydroxyadamantan-2-yl]-1-(3-hydroxyazetidin-1-yl)ethan-1-one: T99 (= T97), L101 (≠ W99), S145 (= S145), Y152 (≠ V152), P153 (= P153), V155 (≠ R155), Y158 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), K19 (≠ E16), G20 (= G17), I21 (= I18), A40 (= A37), R41 (= R38), S42 (= S39), T67 (≠ S64), M68 (vs. gap), N94 (= N92), I96 (≠ A94), V143 (≠ I143), S145 (= S145), Y158 (= Y158), K162 (= K162)
Sites not aligning to the query:
3hfgA Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an sulfonyl-piperazine inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 7:185/258 of 3hfgA
- active site: S145 (= S145), Y158 (= Y158), K162 (= K162)
- binding (2R)-4-[4-fluoro-2-(trifluoromethyl)phenyl]-2-methyl-1-{[3-(1H-1,2,4-triazol-1-yl)phenyl]sulfonyl}piperazine: I96 (≠ A94), L101 (≠ W99), L146 (≠ V146), A147 (= A147), Y152 (≠ V152), Y158 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), G20 (= G17), I21 (= I18), R41 (= R38), S42 (= S39), T67 (≠ S64), M68 (vs. gap), N94 (= N92), I96 (≠ A94), V143 (≠ I143), S145 (= S145), Y158 (= Y158), K162 (= K162)
Sites not aligning to the query:
3czrA Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with arylsulfonylpiperazine inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 13:191/265 of 3czrA
- active site: S151 (= S145), Y164 (= Y158), K168 (= K162)
- binding (2R)-1-[(4-tert-butylphenyl)sulfonyl]-2-methyl-4-(4-nitrophenyl)piperazine: A153 (= A147), Y158 (≠ V152), P159 (= P153), Y164 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G13), S24 (= S15), G26 (= G17), I27 (= I18), R47 (= R38), S48 (= S39), T73 (≠ S64), M74 (vs. gap), N100 (= N92), I102 (≠ A94), V149 (≠ I143), S151 (= S145), Y164 (= Y158), K168 (= K162)
Sites not aligning to the query:
4ijuB Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3- yl]bicyclo[2.2.1]heptan-1-ol (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 23:201/282 of 4ijuB
- active site: S161 (= S145), Y174 (= Y158), K178 (= K162)
- binding (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol: T115 (= T97), S161 (= S145), L162 (≠ V146), Y168 (≠ V152), Y174 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G32 (= G13), S34 (= S15), G36 (= G17), I37 (= I18), A56 (= A37), R57 (= R38), S58 (= S39), T83 (≠ S64), M84 (vs. gap), N110 (= N92), I112 (≠ A94), V159 (≠ I143), S161 (= S145), Y174 (= Y158), K178 (= K162)
Sites not aligning to the query:
- binding (1s,4s)-4-[8-(2-fluorophenoxy)[1,2,4]triazolo[4,3-a]pyridin-3-yl]bicyclo[2.2.1]heptan-1-ol: 207, 214
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 206, 207, 208, 209, 211, 213, 214
3pdjA Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 13:191/272 of 3pdjA
- active site: S151 (= S145), Y164 (= Y158), K168 (= K162)
- binding N-[trans-4-(3-amino-3-oxopropyl)-4-phenylcyclohexyl]-N-cyclopropyl-4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]benzamide: T105 (= T97), L107 (≠ W99), S151 (= S145), Y158 (≠ V152), Y164 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G13), S24 (= S15), K25 (≠ E16), G26 (= G17), I27 (= I18), A46 (= A37), R47 (= R38), S48 (= S39), T73 (≠ S64), M74 (vs. gap), N100 (= N92), I102 (≠ A94), V149 (≠ I143), S151 (= S145), Y164 (= Y158), K168 (= K162)
Sites not aligning to the query:
- binding N-[trans-4-(3-amino-3-oxopropyl)-4-phenylcyclohexyl]-N-cyclopropyl-4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]benzamide: 197, 204, 207
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 196, 197, 198, 199, 201, 203, 204
3frjB Crystal structure of 11b-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with piperidyl benzamide inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 13:191/265 of 3frjB
- active site: S151 (= S145), Y164 (= Y158), K168 (= K162)
- binding N-{1-[(1-carbamoylcyclopropyl)methyl]piperidin-4-yl}-N-cyclopropyl-4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]benzamide: S151 (= S145), Y158 (≠ V152), Y164 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G13), S24 (= S15), G26 (= G17), I27 (= I18), R47 (= R38), S48 (= S39), T73 (≠ S64), M74 (vs. gap), N100 (= N92), I102 (≠ A94), V149 (≠ I143), S151 (= S145), Y164 (= Y158), K168 (= K162)
Sites not aligning to the query:
- binding N-{1-[(1-carbamoylcyclopropyl)methyl]piperidin-4-yl}-N-cyclopropyl-4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]benzamide: 197, 204, 207, 214
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 196, 198, 199, 201, 203, 204
3d4nA Crystal structure of human 11-beta-hydroxysteroid dehydrogenase (hsd1) in complex with sulfonamide inhibitor (see paper)
37% identity, 67% coverage: 4:185/270 of query aligns to 12:190/261 of 3d4nA
- active site: S150 (= S145), Y163 (= Y158), K167 (= K162)
- binding 1-{[(3R)-3-methyl-4-({4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]phenyl}sulfonyl)piperazin-1-yl]methyl}cyclopropanecarboxamide: T104 (= T97), A152 (= A147), Y157 (≠ V152), Y163 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G13), S23 (= S15), G25 (= G17), I26 (= I18), R46 (= R38), S47 (= S39), M73 (vs. gap), N99 (= N92), I101 (≠ A94), V148 (≠ I143), S150 (= S145), Y163 (= Y158), K167 (= K162)
Sites not aligning to the query:
- binding 1-{[(3R)-3-methyl-4-({4-[(1S)-2,2,2-trifluoro-1-hydroxy-1-methylethyl]phenyl}sulfonyl)piperazin-1-yl]methyl}cyclopropanecarboxamide: 196, 206, 212
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 195, 196, 197, 198, 200, 202, 203
Query Sequence
>6936200 FitnessBrowser__SB2B:6936200
MDGLMDKVVILTGASEGIGRALARELARLGCHLVLTARSETRLQSLALELAQEQGAQADV
LVHSADLTHPHECRELIDACIARFGRLDILINNAGMTMWSRFDELEDLAILEQIMAVNYL
APARLTHMALPHLKHSQGQVVAIASVAGLTGVPTRSGYAASKHAMMGFFDSLRIELADDK
VAVTVICPDFVVSQIHKRALDGKGNPLGTTPMKEDKIMSAEACAVAMVPAIACRERLLIM
SRRGRLGRWVRLLWPSLIDKLAKKAIAGGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory