Comparing 6936246 FitnessBrowser__SB2B:6936246 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
32% identity, 88% coverage: 3:171/193 of query aligns to 2:170/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
32% identity, 88% coverage: 3:171/193 of query aligns to 2:170/207 of 1h2eA
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 85% coverage: 2:165/193 of query aligns to 7:174/211 of P36623
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
35% identity, 54% coverage: 5:109/193 of query aligns to 4:102/209 of 4qihA
Sites not aligning to the query:
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 54% coverage: 5:109/193 of query aligns to 6:104/223 of P9WIC7
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
35% identity, 54% coverage: 5:109/193 of query aligns to 5:103/217 of 4pzaB
Sites not aligning to the query:
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
31% identity, 68% coverage: 7:138/193 of query aligns to 8:137/257 of Q7ZVE3
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
28% identity, 78% coverage: 3:153/193 of query aligns to 2:152/207 of 4ij6A
Q9HIJ2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) (see paper)
36% identity, 46% coverage: 6:94/193 of query aligns to 5:88/200 of Q9HIJ2
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
38% identity, 49% coverage: 3:96/193 of query aligns to 2:86/196 of 6m1xC
Sites not aligning to the query:
5hr5A Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
26% identity, 88% coverage: 2:170/193 of query aligns to 223:384/424 of 5hr5A
Sites not aligning to the query:
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
26% identity, 88% coverage: 2:170/193 of query aligns to 219:380/425 of 5htkA
Sites not aligning to the query:
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
26% identity, 88% coverage: 2:170/193 of query aligns to 249:410/505 of O60825
Sites not aligning to the query:
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
37% identity, 49% coverage: 3:96/193 of query aligns to 2:86/198 of 5zr2C
Sites not aligning to the query:
P26285 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Bos taurus (Bovine) (see paper)
26% identity, 88% coverage: 2:170/193 of query aligns to 250:411/531 of P26285
Sites not aligning to the query:
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
40% identity, 32% coverage: 5:66/193 of query aligns to 4:64/230 of 3fdzA
Sites not aligning to the query:
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
40% identity, 32% coverage: 5:66/193 of query aligns to 4:64/249 of Q3JWH7
Sites not aligning to the query:
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
40% identity, 32% coverage: 5:66/193 of query aligns to 4:64/229 of 3gp3A
Sites not aligning to the query:
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
40% identity, 32% coverage: 5:66/193 of query aligns to 4:64/248 of 3gp5A
Sites not aligning to the query:
>6936246 FitnessBrowser__SB2B:6936246
MPTDIFLLRHGQTEFNAQRRLQGHCDSPLTLLGREQARAYGQALKRCGDLDDYALIASPL
GRAMETAAIVAQTLGRDPESVIPDQRVKEAGLGEWEQEHIPDIHSSWPGLEAIPGWYIKG
PGAEPLSALRERLLHWLEDPATPQKVILVSHGVTGVVLRGLLQNLGDDEMWRQDKPQDAF
YYFSQSRLHRISC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory