Comparing 6936298 FitnessBrowser__SB2B:6936298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
55% identity, 96% coverage: 6:163/165 of query aligns to 13:171/180 of 2jlmF
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
50% identity, 96% coverage: 6:163/165 of query aligns to 7:164/165 of 4mbuA
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
51% identity, 90% coverage: 15:163/165 of query aligns to 15:164/171 of 2j8mA
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
51% identity, 90% coverage: 15:163/165 of query aligns to 16:165/172 of A6VCX3
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
50% identity, 91% coverage: 15:164/165 of query aligns to 14:164/170 of 2j8rA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
46% identity, 93% coverage: 13:165/165 of query aligns to 14:166/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
46% identity, 93% coverage: 13:165/165 of query aligns to 12:164/171 of Q8ZPD3
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
45% identity, 87% coverage: 18:160/165 of query aligns to 20:162/165 of 4jwpA
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
38% identity, 92% coverage: 15:165/165 of query aligns to 16:167/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
34% identity, 91% coverage: 15:164/165 of query aligns to 17:168/181 of 5dwnA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
29% identity, 92% coverage: 15:165/165 of query aligns to 15:164/176 of 6m7gA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
29% identity, 92% coverage: 15:165/165 of query aligns to 15:164/179 of 5wphA
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
29% identity, 89% coverage: 18:164/165 of query aligns to 17:162/173 of 5t7dA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
29% identity, 89% coverage: 18:164/165 of query aligns to 18:163/175 of 5t7eD
P76594 Peptidyl-lysine N-acetyltransferase PatZ; Protein lysine acetyltransferase; EC 2.3.1.- from Escherichia coli (strain K12) (see paper)
29% identity, 73% coverage: 31:151/165 of query aligns to 761:879/886 of P76594
Q8ZMX2 Peptidyl-lysine N-acetyltransferase Pat; Protein lysine acetyltransferase; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 46% coverage: 76:151/165 of query aligns to 803:879/886 of Q8ZMX2
Sites not aligning to the query:
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
37% identity, 33% coverage: 92:145/165 of query aligns to 92:145/164 of 2ge3A
Sites not aligning to the query:
>6936298 FitnessBrowser__SB2B:6936298
MHIASCQFEQHGAIIQHIFNHAIANTTALYEYEPRDMARIAAWFAQKEGLYPVLGAFDEK
GDLMGFASYGPFRGFPANLYSVEHSVYVHSDHRGKGVALKLMQALIQAAKDAGLHMMVGG
IDASNNASIALHKKLGFEHAGTLKEVGYKFNRWLDLAFYQLKLSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory