SitesBLAST
Comparing 6936303 FitnessBrowser__SB2B:6936303 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
49% identity, 97% coverage: 7:487/498 of query aligns to 9:484/502 of P07117
- R257 (= R256) mutation to C: Sodium-independent binding affinity for proline.
- C281 (≠ T280) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (≠ S339) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (≠ S344) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (= R371) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
Q9NY91 Probable glucose sensor protein SLC5A4; Solute carrier family 5 member 4 from Homo sapiens (Human) (see paper)
23% identity, 85% coverage: 9:432/498 of query aligns to 32:492/659 of Q9NY91
- E457 (≠ S397) mutation to Q: Confers sugar transport activity not found in the wild-type protein. Increased sensitivity to inhibitor phlorizin.
P11170 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
21% identity, 85% coverage: 9:432/498 of query aligns to 32:492/662 of P11170
- C255 (≠ S221) modified: Disulfide link with 608
- Q457 (≠ S397) mutation to W: Drasticly decreased affinity for glucose and phlorizin.
- T460 (≠ W400) mutation to W: Decreased affinity for glucose and phlorizin.
Sites not aligning to the query:
- 608 modified: Disulfide link with 255
7wmvA Structure of human sglt1-map17 complex bound with lx2761 (see paper)
22% identity, 84% coverage: 9:425/498 of query aligns to 15:468/602 of 7wmvA
- binding N-[2-(dimethylamino)ethyl]-2-methyl-2-[4-[4-[[2-methyl-5-[(2S,3R,4R,5S,6R)-6-methylsulfanyl-3,4,5-tris(oxidanyl)oxan-2-yl]phenyl]methyl]phenyl]butanoylamino]propanamide: N61 (≠ D54), H66 (≠ M59), L70 (= L63), I81 (≠ A79), F84 (≠ L82), L257 (= L241), M266 (vs. gap), L269 (vs. gap), T270 (≠ G244), Y273 (= Y247), W274 (≠ F248), F436 (≠ L393), D437 (≠ S394), Q440 (≠ S397)
Sites not aligning to the query:
P13866 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Homo sapiens (Human) (see 6 papers)
22% identity, 84% coverage: 9:425/498 of query aligns to 32:485/664 of P13866
- N51 (≠ S27) to S: in GGM; slightly decreased activity; dbSNP:rs17683011
- W67 (≠ P43) mutation to A: Strong reduction in D-glucose transporter activity.
- S77 (= S53) mutation to A: Loss of activity.
- H83 (≠ M59) mutation to L: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and C-290.; mutation to Q: Loss of D-glucose transporter activity.
- R135 (= R116) to W: in GGM; loss of activity
- S159 (= S141) to P: in GGM; loss of activity
- A166 (≠ G148) to T: in GGM; about 90% reduction in activity
- D204 (= D186) mutation to A: Loss of activity.
- N248 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to Q: Loss of N-glycosylation.
- C255 (vs. gap) modified: Disulfide link with 511
- W276 (= W243) to L: in GGM; about 95% reduction in activity
- T287 (≠ G244) mutation to A: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with L-83 and C-290.; mutation to N: Loss of D-glucose transporter activity. Has strict selectivity for D-galactose.; mutation T->S,A: Has normal D-glucose and D-galactose transporter activity.
- Y290 (= Y247) mutation to C: Loss of D-galactose transporter activity. Has strict selectivity for D-glucose. Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and L-83.
- W291 (≠ F248) mutation to A: Loss of D-glucose transporter activity.
- C292 (≠ G249) to Y: in GGM; loss of activity; mutation to A: Has no effect on water permeability.
- Q295 (≠ H252) to R: in GGM; loss of activity
- R300 (= R256) to S: in GGM; loss of activity
- A304 (≠ I260) to V: in GGM; impairs trafficking to the plasma membrane
- K321 (≠ G273) mutation to Q: Acquires D-mannose and D-allose transporter activity comparable to glucose and galactose.
- C345 (≠ K297) modified: Disulfide link with 351
- C351 (vs. gap) modified: Disulfide link with 345
- C355 (vs. gap) modified: Disulfide link with 361
- C361 (≠ E306) modified: Disulfide link with 355
- N363 (≠ I308) mutation to A: Loss of water permeation.
- L369 (= L311) to S: in GGM; loss of activity
- R379 (≠ S322) to Q: in GGM; loss of activity
- A388 (= A331) to V: in GGM; loss of activity
- S396 (= S339) mutation to A: Loss of activity.
- F405 (≠ L348) to S: in GGM; loss of activity
- A411 (= A355) to T: in GGM; slightly decreased activity; dbSNP:rs17683430
- G426 (= G370) to R: in GGM; loss of activity
- Q451 (≠ S391) mutation to A: Strong reduction in water permeation.
- L452 (≠ I392) mutation to A: Loss of water permeation.
- D454 (≠ S394) mutation to A: Has no effect on water permeation.
- Q457 (≠ S397) mutation to A: Loss of D-glucose transporter activity.; mutation to C: Strong reduction in D-glucose transporter activity.
- T460 (≠ W400) mutation to A: Loss of D-glucose transporter activity.
- V470 (≠ L410) to N: in GGM; about 90% reduction in activity; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 191:664 natural variant: Missing (in GGM; loss of activity)
- 379:664 natural variant: Missing (in GGM; loss of activity)
- 499 R → H: in GGM; impairs trafficking to the plasma membrane; decreases the sugar affinity
- 511 modified: Disulfide link with 255
- 517 modified: Disulfide link with 522
- 522 modified: Disulfide link with 517
- 615 H → Q: in GGM; slightly decreased activity
- 641 W→A: Slightly reduced D-glucose transporter activity.
- 660:661 HA→WG: Loss of D-glucose transporter activity.
Q9ET37 Solute carrier family 5 member 4A; SGLT3-a from Mus musculus (Mouse) (see paper)
23% identity, 94% coverage: 9:474/498 of query aligns to 32:546/656 of Q9ET37
- E457 (≠ S397) mutation to Q: Confers sodium-dependent sugar transport activity not found in the wild type protein.
7sl8A Cryoem structure of sglt1 at 3.4 a resolution (see paper)
22% identity, 64% coverage: 107:425/498 of query aligns to 94:453/582 of 7sl8A
Sites not aligning to the query:
Q9GZV3 High affinity choline transporter 1; hCHT1; Hemicholinium-3-sensitive choline transporter; CHT; Solute carrier family 5 member 7 from Homo sapiens (Human) (see 5 papers)
24% identity, 76% coverage: 7:386/498 of query aligns to 9:397/580 of Q9GZV3
- D48 (≠ Q40) to G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039768
- G65 (= G57) to E: in CMS20; loss of choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039765
- I89 (vs. gap) to V: 40% reduction in choline transmembrane transporter activity; found in 0.06 of Ashkenazi Jews; dbSNP:rs1013940; mutation to A: Decreased choline transmembrane transporter activity, only 20% of wild-type choline uptake activity.
- P105 (≠ R95) to S: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039766
- Y111 (≠ A106) to H: in CMS20; no effect on localization at plasma membrane
- Y175 (= Y173) to C: in CMS20; uncertain significance; dbSNP:rs1331713195
- I291 (≠ T287) to T: in CMS20; uncertain significance; dbSNP:rs375397889
- V344 (≠ I333) to L: in CMS20; uncertain significance
- R361 (≠ E350) to Q: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs147656110
Sites not aligning to the query:
- 418 F → V: in CMS20; uncertain significance
- 446 R → G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane
- 451 E→Q: Decreased choline transmembrane transporter activity, only 5% of wild-type choline uptake activity.
- 527:532 Dileucine-like motif
- 530 I→A: No change in protein internalization. No change in choline transmembrane transporter activity.
- 531 L→A: Loss of protein internalization to vesicular structures in neurons. Increased choline transmembrane transporter activity.
- 531:532 LV→AA: Decreased protein internalization; when associated with V-538. Increased choline transmembrane transporter activity; when associated with V-538.
- 532 V→A: Decreased protein internalization. Increased choline transmembrane transporter activity.
- 538 K→V: Decreased protein internalization; when associated with 531-L-V-532. Increased choline transmembrane transporter activity; when associated with 531-L-V-532.
7slaA Cryoem structure of sglt1 at 3.15 angstrom resolution (see paper)
22% identity, 64% coverage: 107:425/498 of query aligns to 95:454/585 of 7slaA
Sites not aligning to the query:
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
23% identity, 84% coverage: 5:424/498 of query aligns to 16:444/643 of Q92911
- A102 (≠ Y89) natural variant: A -> P
- H226 (≠ S219) mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- D237 (≠ L225) mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- Y242 (≠ E230) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- T243 (≠ H231) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
Sites not aligning to the query:
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
Q9Y289 Sodium-dependent multivitamin transporter; Na(+)-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6 from Homo sapiens (Human) (see 10 papers)
24% identity, 83% coverage: 18:432/498 of query aligns to 41:463/635 of Q9Y289
- C68 (≠ P43) mutation to A: No effect on biotin transport.
- T78 (≠ S53) mutation to A: Reduced membrane localization. Decrease in biotin transport.
- C104 (≠ A79) mutation to A: No effect on biotin transport.
- R123 (= R97) to L: in SMVTD; reduced membrane localization; impaired biotin transport
- S128 (≠ A102) mutation to A: No effect on biotin transport.
- N138 (= N118) mutation to A: Reduced protein levels. Decrease in biotin transport.
- C144 (≠ I127) mutation to A: No effect on biotin transport.
- Y162 (≠ V145) to C: in COMNB; no effect on membrane localization
- C187 (≠ V170) mutation to A: No effect on biotin transport.
- S242 (≠ D227) mutation to A: No effect on biotin transport.
- S283 (≠ A259) mutation to A: No effect on protein levels or membrane localization.
- T286 (≠ S262) mutation to A: Resistant to phorbol 12-myristate 13-acetate (PMA)-induced inhibition of biotin transport. No effect on protein levels or membrane localization.
- C294 (≠ R270) mutation to A: Reduced membrane localization. Decrease in biotin transport (decreased Vmax, no change in Km).; mutation C->S,M: Decrease in biotin transport.
- C309 (≠ L285) mutation to A: No effect on biotin transport.
- C358 (≠ A328) mutation to A: No effect on biotin transport.
- T366 (= T336) mutation to A: No effect on biotin transport.
- R400 (≠ G370) to T: in SMVTD; impaired biotin transport; dbSNP:rs370950187
- C410 (≠ V374) mutation to A: No effect on biotin transport.
- S429 (≠ A401) to G: in COMNB; no effect on membrane localization
- C443 (≠ L412) mutation to A: No effect on biotin transport.
- C450 (≠ R419) mutation to A: No effect on biotin transport.
Sites not aligning to the query:
- 94:635 natural variant: Missing (in SMVTD and COMNB; reduced membrane localization; impaired biotin transport; dbSNP:rs994218778)
- 481 S → F: in dbSNP:rs1395
- 489 N→A: Slight decrease in protein levels. Decrease in biotin transport.
- 498 N→A: No effect on biotin transport.
- 534 N→A: No effect on biotin transport.
- 567:635 mutation Missing: Loss of biotin transport. Loss of membrane localization.
- 570:635 mutation Missing: Loss of biotin transport. Loss of membrane localization.
- 575:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 577 C→A: No effect on biotin transport.
- 583 C→A: No effect on biotin transport.
- 584:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 600:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 612:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 616:635 mutation Missing: Loss of apical membrane localization in polarized cells. Basolateral localization in polarized cells.
- 620:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
- 624:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
- 627 T→A: No effect on biotin transport.
- 628 mutation C->A,S: Decrease in biotin transport.
- 632:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
8hezA Structure of human sglt2-map17 complex with dapagliflozin (see paper)
24% identity, 71% coverage: 9:364/498 of query aligns to 9:401/582 of 8hezA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D54), G59 (≠ W58), H60 (≠ M59), G63 (= G62), L64 (= L63), T67 (vs. gap), F78 (≠ M70), E79 (≠ G71), V266 (vs. gap), S267 (vs. gap), W271 (≠ F248), K301 (≠ M277)
- binding sodium ion: A53 (= A52), I56 (≠ M55), G57 (≠ S56), A369 (= A332), S372 (= S335), S373 (≠ T336)
Sites not aligning to the query:
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 437
- binding : 568, 571, 572, 575, 576, 579, 580
8hdhA Structure of human sglt2-map17 complex with canagliflozin (see paper)
24% identity, 71% coverage: 9:364/498 of query aligns to 9:401/586 of 8hdhA
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D54), G59 (≠ W58), H60 (≠ M59), G63 (= G62), L64 (= L63), F78 (≠ M70), E79 (≠ G71), S267 (vs. gap), W271 (≠ F248)
- binding sodium ion: A53 (= A52), S54 (= S53), I56 (≠ M55), G57 (≠ S56), A369 (= A332), S372 (= S335), S373 (≠ T336)
Sites not aligning to the query:
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 434, 437, 506
- binding : 575, 579, 580, 583, 584
8hb0A Structure of human sglt2-map17 complex with ta1887 (see paper)
24% identity, 71% coverage: 9:364/498 of query aligns to 9:401/586 of 8hb0A
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D54), H60 (≠ M59), G63 (= G62), L64 (= L63), T67 (vs. gap), V75 (≠ M67), F78 (≠ M70), E79 (≠ G71), V137 (≠ A142), V266 (vs. gap), S267 (vs. gap), W271 (≠ F248)
- binding sodium ion: A53 (= A52), I56 (≠ M55), G57 (≠ S56), A369 (= A332), S372 (= S335), S373 (≠ T336)
Sites not aligning to the query:
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 437
- binding : 575, 576, 579, 580, 583, 584
7vsiA Structure of human sglt2-map17 complex bound with empagliflozin (see paper)
24% identity, 71% coverage: 9:364/498 of query aligns to 9:401/586 of 7vsiA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ D54), H60 (≠ M59), G63 (= G62), L64 (= L63), V75 (≠ M67), F78 (≠ M70), E79 (≠ G71), V266 (vs. gap), S267 (vs. gap), Y270 (= Y247)
Sites not aligning to the query:
P31639 Sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2 from Homo sapiens (Human) (see paper)
23% identity, 71% coverage: 9:364/498 of query aligns to 29:421/672 of P31639
- V95 (≠ M67) mutation to A: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- F98 (≠ M70) mutation to A: Slightly decreases D-glucose transporter activity. Abolishes the binding to inhibitor, empagliflozin.
- V157 (≠ A142) mutation to A: Decreases D-glucose transporter activity.
- L283 (vs. gap) mutation to M: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
Sites not aligning to the query:
- 453 F→A: Slightly decreases D-glucose transporter activity. Greatly reduces the binding to inhibitor, empagliflozin.
8hg7A Structure of human sglt2-map17 complex with sotagliflozin (see paper)
24% identity, 71% coverage: 9:364/498 of query aligns to 9:401/590 of 8hg7A
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: N55 (≠ D54), G59 (≠ W58), H60 (≠ M59), G63 (= G62), L64 (= L63), E79 (≠ G71), V266 (vs. gap), S267 (vs. gap), Y270 (= Y247), W271 (≠ F248), K301 (≠ M277)
- binding sodium ion: A53 (= A52), S54 (= S53), I56 (≠ M55), G57 (≠ S56), A369 (= A332), S372 (= S335), S373 (≠ T336)
Sites not aligning to the query:
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: 433, 437
- binding : 579, 583, 584, 587, 588
3dh4A Crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus (see paper)
22% identity, 89% coverage: 52:493/498 of query aligns to 33:487/512 of 3dh4A
7yniA Structure of human sglt1-map17 complex bound with substrate 4d4fdg in the occluded conformation (see paper)
20% identity, 84% coverage: 9:425/498 of query aligns to 14:447/566 of 7yniA
- binding (2R,3R,4R,5S,6R)-5-fluoranyl-6-(hydroxymethyl)oxane-2,3,4-triol: H51 (= H44), E70 (≠ P64), L248 (vs. gap), Y252 (= Y247), F415 (≠ L393), Q419 (≠ S397)
Sites not aligning to the query:
Query Sequence
>6936303 FitnessBrowser__SB2B:6936303
MEYSSYISLALYFIAMLAIGLFAYRNSTDDLAGYMLGGRQVSPHVTALSAGASDMSGWML
MGLPGAMFTMGYDALWIAAGLLLGALLNYLLVAPRLRVFTEAADDALTLPDFFSKRFNKD
NGSVRMISAAVIILFFTLYTSAGLVAGGKFFESAFGLGYQTGLLLTVSVVVAYTLLGGFL
AVSLTDFVQGCIMFLALVLVPLVALQEFNSSTDMLAQASRSITPLADSFEHMGILAIVSS
LAWGLGYFGQPHIIVRFMAIRSVKDIAVARNIGMSWMLVTILGALATGLIGVAYVNKFKP
GLDDGETIFILFAEILFHPLISGFLLAAILAAIMSTISSQLLVSSSSLSEDVYRALFHKE
MDQKATVTAGRIGVLAVAAVATLLALDNNASILSLVSNAWAGFGAAFGPLVLLSLFWPRM
THSGAVAGILCGAGTVLVWSQVPLLENGLPLSSLIYEIVPGFIVSTLAIVLVSYADQAPC
KSTQKAFKLSRDRLKQVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory