Comparing 6936372 FitnessBrowser__SB2B:6936372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
28% identity, 97% coverage: 1:378/389 of query aligns to 1:385/413 of P32140
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
28% identity, 97% coverage: 1:378/389 of query aligns to 1:385/416 of 2zblA
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
28% identity, 97% coverage: 1:378/389 of query aligns to 13:397/425 of 7ag4D
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
22% identity, 97% coverage: 13:388/389 of query aligns to 18:416/423 of 8h1lB
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
24% identity, 97% coverage: 13:388/389 of query aligns to 22:400/407 of 3wkiA
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
24% identity, 97% coverage: 13:388/389 of query aligns to 22:400/410 of 3wkhA
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
24% identity, 97% coverage: 13:388/389 of query aligns to 22:400/410 of 3wkgA
P0DKY4 Cellobiose 2-epimerase; CE; EC 5.1.3.11 from Ruminococcus albus (see paper)
22% identity, 96% coverage: 13:385/389 of query aligns to 11:383/389 of P0DKY4
7d5gA Crystal structure of the csce with ligand to have a insight into the catalytic mechanism
21% identity, 98% coverage: 4:386/389 of query aligns to 6:387/389 of 7d5gA
8wbvA The crystal structure of linear mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
21% identity, 98% coverage: 4:386/389 of query aligns to 8:389/391 of 8wbvA
8wbuA The crystal structure of circular mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
21% identity, 98% coverage: 4:386/389 of query aligns to 8:389/391 of 8wbuA
P17560 N-acylglucosamine 2-epimerase; AGE; GlcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; Renin-binding protein; RnBP; EC 5.1.3.8 from Sus scrofa (Pig) (see paper)
28% identity, 30% coverage: 272:388/389 of query aligns to 275:397/402 of P17560
Sites not aligning to the query:
P51606 N-acylglucosamine 2-epimerase; AGE; GlcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; Renin-binding protein; RnBP; EC 5.1.3.8 from Homo sapiens (Human) (see paper)
28% identity, 25% coverage: 278:373/389 of query aligns to 291:390/427 of P51606
Sites not aligning to the query:
>6936372 FitnessBrowser__SB2B:6936372
MKFYNRDFLLSHSQSILDFYDPRVLDASGGYFHNYYDDGSLFEPGFRQLVSSCRITVNYA
RAADILDKPEYLAHARHGLNYLLNVHLQADERFAWTLKSHRPEDMTQQAYGYAFALLAFA
ACRKSGILKDNNKLLWIYNLLEQRFWQPEYGLYADEIGADGVLSDYRGQNANMHLCEAMI
AAFEASGEGRFLDRAMEIADKIANRQAALTGGIIWEHFTPGFAINWEYNKDDPKNLYRPW
GFQGGHQTEWAKLLLSLARHSHQPWLISRAKTLFDTAFEKSWDKEHGGMVYGFGPNGDWC
DDDKYFWVQAESFAAAAMLYQQTGEQKYLDAYNALWNYAWQHFVDHEHGAWFRVLYRDNR
KYSNEKSTAGAKCDYHTLGACFDSLRDLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory