Comparing 6936373 FitnessBrowser__SB2B:6936373 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
41% identity, 91% coverage: 1:313/343 of query aligns to 1:312/322 of 3lkiB
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
35% identity, 92% coverage: 4:317/343 of query aligns to 3:304/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
35% identity, 92% coverage: 4:317/343 of query aligns to 7:308/310 of 5yggA
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 93% coverage: 3:320/343 of query aligns to 5:309/319 of Q8ZKR2
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
32% identity, 93% coverage: 3:320/343 of query aligns to 1:298/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
32% identity, 90% coverage: 3:309/343 of query aligns to 1:287/297 of 1tz6A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
29% identity, 76% coverage: 5:266/343 of query aligns to 2:252/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
29% identity, 76% coverage: 5:266/343 of query aligns to 3:253/304 of 3ih0A
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
31% identity, 88% coverage: 5:306/343 of query aligns to 8:306/312 of 4wjmA
Q9M394 Fructokinase-like 1, chloroplastic; PEP-associated protein 6; pfkB-type carbohydrate kinase family protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 89% coverage: 5:309/343 of query aligns to 104:453/471 of Q9M394
8cqxA Ribokinase from t.Sp mutant a92g
28% identity, 84% coverage: 31:317/343 of query aligns to 31:297/300 of 8cqxA
6znxC Ribokinase from thermus species
29% identity, 88% coverage: 15:317/343 of query aligns to 2:262/265 of 6znxC
F4I0K2 Fructokinase-like 2, chloroplastic; pfkB-type carbohydrate kinase family protein 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
21% identity, 85% coverage: 5:297/343 of query aligns to 207:532/614 of F4I0K2
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
25% identity, 92% coverage: 4:317/343 of query aligns to 3:304/308 of 3iq0B
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
28% identity, 68% coverage: 34:266/343 of query aligns to 31:258/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 68% coverage: 34:266/343 of query aligns to 31:258/300 of 1v1bA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 68% coverage: 34:266/343 of query aligns to 31:258/309 of Q53W83
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
27% identity, 88% coverage: 4:304/343 of query aligns to 3:282/282 of 7fcaD
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
25% identity, 93% coverage: 4:321/343 of query aligns to 2:308/308 of 2dcnA
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
27% identity, 92% coverage: 4:317/343 of query aligns to 3:291/295 of 7aghA
>6936373 FitnessBrowser__SB2B:6936373
MSKRVLCFGEALIDFLCTGSDEDDGLMLPCYRQYPGGAPANAAVAVAKLGGQARFAGLVG
KDTFGDFLANSLVRYGVDISLLGRHSSAPTSLAFVHLNDDGDRSFSFYRDGGADTLFDAS
VAEASWFENTAVLHLCSNTLTTAQSAEATLTMADRAVAAGLAVSVDVNLRHNLWQGGAAC
KATVMSLVHKAHVLKFAQEELEYLAGSEPQGFIQQLLDSGCKLLLITDGGNPIRAFTGKQ
CLTLPVPKMDVVDTTAGGDGFIGGLLHRIARDGLDTLLESETTFKDALGFAIGCGALAVS
RPGAFPALPGLAEAEAFQASMGDVLHTISVDDSRLPKPCQRSW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory