Comparing 6936424 Sama_0612 D-lactate dehydrogenase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
62% identity, 100% coverage: 1:329/329 of query aligns to 1:329/330 of 4cukA
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
57% identity, 96% coverage: 1:315/329 of query aligns to 8:322/336 of 5z20F
8grvA Dictyostelium discoideum lactate dehydrogenase (dicldha)with NAD
49% identity, 95% coverage: 1:314/329 of query aligns to 3:317/336 of 8grvA
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
47% identity, 99% coverage: 2:328/329 of query aligns to 3:329/331 of 5z21B
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
51% identity, 91% coverage: 29:328/329 of query aligns to 39:344/346 of 4zgsA
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
38% identity, 84% coverage: 46:322/329 of query aligns to 44:321/334 of 3kb6B
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
33% identity, 92% coverage: 1:304/329 of query aligns to 1:304/333 of P17584
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
33% identity, 92% coverage: 1:304/329 of query aligns to 1:304/330 of 1dxyA
P26297 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) (see 2 papers)
35% identity, 90% coverage: 20:314/329 of query aligns to 22:316/333 of P26297
2dldA D-lactate dehydrogenase complexed with nadh and oxamate
33% identity, 90% coverage: 27:323/329 of query aligns to 29:325/337 of 2dldA
Sites not aligning to the query:
P30901 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus helveticus (Lactobacillus suntoryeus) (see paper)
33% identity, 90% coverage: 27:323/329 of query aligns to 29:325/337 of P30901
Sites not aligning to the query:
1j49A Insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus (see paper)
34% identity, 90% coverage: 20:314/329 of query aligns to 22:316/332 of 1j49A
4prlA Crystal structure of d-lactate dehydrogenase with NAD+ from lactobacillus jensenii (see paper)
32% identity, 98% coverage: 1:324/329 of query aligns to 1:324/330 of 4prlA
2yq5C Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. Bulgaricus: NAD complexed form (see paper)
30% identity, 98% coverage: 2:323/329 of query aligns to 2:325/331 of 2yq5C
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
37% identity, 77% coverage: 70:322/329 of query aligns to 66:305/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
37% identity, 77% coverage: 70:322/329 of query aligns to 65:304/526 of 3dc2A
Sites not aligning to the query:
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 64% coverage: 55:263/329 of query aligns to 52:259/299 of 6cwaA
Sites not aligning to the query:
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 64% coverage: 55:263/329 of query aligns to 52:259/297 of 6rj3A
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 64% coverage: 55:263/329 of query aligns to 53:260/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 64% coverage: 55:263/329 of query aligns to 53:260/303 of 6plgA
>6936424 Sama_0612 D-lactate dehydrogenase (RefSeq)
MKIGFFSAKHYDMQHFDRTNASFGAHIEYFDSRLCMQTVKLAYGFEVICAFVNDELSAEV
LNELHGNGTRVIAMRCAGFNNVDLEEAKHLGMTVVNVPAYSPESVAEHTVALMLTLNRKI
HKAYQRTRDANFSLEGLVGFNMHGKTVGVIGTGKIGLATIRILLGFGCKVVAFDPFPSPA
VEALGVPYLELDELLKLCDVVSLHCPLTKENHHLLRAETFAKMKPGVMVINTSRGGLLNA
FDAMEALKVGQIGALGLDVYENEKELFFEDKSNEVIQDDVFRRLSACHNVVFTGHQAFLT
EEALGAIATTTLTNVQKALAGERCGNELF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory