SitesBLAST
Comparing 6936430 FitnessBrowser__SB2B:6936430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1hyuA Crystal structure of intact ahpf (see paper)
60% identity, 98% coverage: 1:510/520 of query aligns to 1:517/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G218), P222 (= P219), A223 (= A220), E243 (≠ D240), G247 (= G244), Q248 (= Q245), N257 (= N254), S289 (≠ K286), A290 (= A287), T322 (= T315), G323 (= G316), W326 (= W319), C345 (= C338), D488 (= D481), K495 (= K488), Q496 (= Q489), I497 (= I490)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
58% identity, 99% coverage: 1:514/520 of query aligns to 1:521/521 of 4ykgA
- active site: C345 (= C338), C348 (= C341), D349 (= D342)
- binding flavin-adenine dinucleotide: G221 (= G218), P222 (= P219), A223 (= A220), G242 (≠ A239), E243 (≠ D240), G247 (= G244), Q248 (= Q245), T252 (= T249), N257 (= N254), S289 (≠ K286), A290 (= A287), T322 (= T315), G323 (= G316), C348 (= C341), G487 (= G480), D488 (= D481), Q496 (= Q489), I497 (= I490)
- binding nicotinamide-adenine-dinucleotide: I361 (= I354), G364 (= G357), S366 (= S359), E385 (= E378), F386 (= F379), I449 (= I442), M467 (≠ R460), P493 (≠ A486)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
58% identity, 99% coverage: 1:514/520 of query aligns to 1:521/521 of 4ykfA
- active site: C345 (= C338), C348 (= C341), D349 (= D342)
- binding flavin-adenine dinucleotide: G221 (= G218), P222 (= P219), A223 (= A220), G242 (≠ A239), E243 (≠ D240), G247 (= G244), Q248 (= Q245), N257 (= N254), A290 (= A287), T322 (= T315), G323 (= G316), C348 (= C341), N454 (= N447), D488 (= D481), Q496 (= Q489), I497 (= I490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I354), G364 (= G357), N365 (= N358), S366 (= S359), E385 (= E378), F386 (= F379), K391 (≠ R384), I449 (= I442), M467 (≠ R460)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
58% identity, 99% coverage: 1:514/520 of query aligns to 1:521/521 of P35340
- K53 (≠ T53) modified: N6-acetyllysine
- K354 (= K347) modified: N6-acetyllysine
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
41% identity, 57% coverage: 210:505/520 of query aligns to 5:300/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V246), L47 (≠ G251), N50 (= N254), C133 (= C338), C136 (= C341), D137 (= D342)
- binding flavin-adenine dinucleotide: V10 (= V215), G11 (= G216), A15 (= A220), D34 (≠ A239), K35 (≠ D240), G40 (= G244), L41 (≠ Q245), T42 (≠ V246), A45 (≠ T249), P46 (≠ V250), N50 (= N254), V82 (≠ Q285), T110 (= T315), G111 (= G316), S154 (= S359), Q241 (≠ N447), G275 (= G480), D276 (= D481), A283 (≠ K488), Q284 (= Q489), I285 (= I490)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
36% identity, 58% coverage: 207:508/520 of query aligns to 2:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G218), P14 (= P219), A15 (= A220), E34 (≠ A239), Q35 (≠ D240), G40 (= G244), Q41 (= Q245), T45 (= T249), N50 (= N254), V82 (vs. gap), T110 (= T315), G111 (= G316), Y114 (≠ W319), C136 (= C341), V242 (≠ N447), G275 (= G480), D276 (= D481), Q284 (= Q489), I285 (= I490)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
35% identity, 58% coverage: 210:509/520 of query aligns to 2:301/303 of 5mh4A
- active site: V34 (vs. gap), P35 (vs. gap), M39 (≠ V246), E44 (≠ G251), C130 (= C338), C133 (= C341), D134 (= D342)
- binding flavin-adenine dinucleotide: G10 (= G218), P11 (= P219), A12 (= A220), E31 (≠ D240), R32 (= R241), G37 (= G244), Q38 (= Q245), T42 (= T249), N47 (= N254), G77 (≠ A287), V79 (vs. gap), T107 (= T315), G108 (= G316), E155 (≠ A363), V239 (≠ N447), F242 (≠ W450), G272 (= G480), D273 (= D481), Q281 (= Q489), I282 (= I490)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I354), G147 (= G355), G148 (= G356), G149 (= G357), D150 (≠ N358), S151 (= S359), E154 (= E362), H170 (≠ E378), R171 (≠ F379), R172 (≠ D380), R176 (= R384), V234 (≠ I442), G235 (= G443), R280 (≠ K488), Q281 (= Q489)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
37% identity, 57% coverage: 207:500/520 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G216), G14 (= G218), P15 (= P219), A16 (= A220), F34 (≠ V238), E35 (≠ A239), K36 (≠ D240), G41 (= G244), A42 (≠ Q245), V83 (≠ A287), T112 (= T315), G113 (= G316), G276 (= G480), D277 (= D481)
- binding nicotinamide-adenine-dinucleotide: G153 (= G356), G154 (= G357), S156 (= S359), Q175 (≠ E378), N176 (≠ F379), T181 (≠ R384), V238 (≠ I442)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 59% coverage: 211:519/520 of query aligns to 16:329/335 of P9WHH1
- SGPA 22:25 (≠ AGPA 217:220) binding
- Y32 (= Y227) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 240:245, 38% identical) binding
- N60 (= N254) binding
- V93 (≠ Q285) binding
- C145 (= C338) modified: Disulfide link with 148, Redox-active
- C148 (= C341) modified: Disulfide link with 145, Redox-active
- S166 (= S359) binding
- H185 (≠ E378) binding
- R191 (= R384) binding
- I248 (= I442) binding
- Y268 (≠ E462) binding
- D288 (= D481) binding
- R295 (≠ K488) binding
- RQAV 295:298 (≠ KQII 488:491) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
36% identity, 58% coverage: 211:512/520 of query aligns to 7:310/313 of 2a87A
- active site: F39 (= F242), L43 (≠ V246), D48 (≠ G251), C136 (= C338), C139 (= C341), D140 (= D342)
- binding flavin-adenine dinucleotide: G12 (= G216), S13 (≠ A217), G14 (= G218), P15 (= P219), A16 (= A220), F34 (≠ A239), E35 (≠ D240), G36 (vs. gap), G40 (= G243), G41 (= G244), A42 (≠ Q245), L43 (≠ V246), T46 (= T249), V49 (≠ I252), N51 (= N254), D83 (≠ N284), V84 (≠ Q285), M113 (≠ T315), C139 (= C341), G278 (= G480), D279 (= D481), R286 (≠ K488), Q287 (= Q489), A288 (≠ I490), V289 (≠ I491)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (≠ M322), G155 (= G357), D156 (≠ N358), S157 (= S359), H176 (≠ E378), R177 (≠ F379), R178 (≠ D380), R182 (= R384), I239 (= I442), Y259 (≠ E462), R283 (≠ S485), R286 (≠ K488)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
36% identity, 58% coverage: 210:508/520 of query aligns to 4:303/306 of 5uthA
- active site: C133 (= C338), C136 (= C341), D137 (= D342)
- binding flavin-adenine dinucleotide: I9 (≠ V215), G10 (= G216), S11 (≠ A217), G12 (= G218), P13 (= P219), A14 (= A220), F32 (≠ A239), E33 (≠ D240), G34 (vs. gap), Q36 (≠ R241), G39 (= G244), A40 (≠ Q245), L41 (≠ V246), N49 (= N254), D81 (≠ N284), V82 (≠ Q285), M110 (≠ T315), G111 (= G316), C136 (= C341), G275 (= G480), D276 (= D481), R283 (≠ K488), Q284 (= Q489), A285 (≠ I490), A288 (= A493)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
36% identity, 58% coverage: 210:508/520 of query aligns to 3:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V215), G9 (= G216), S10 (≠ A217), G11 (= G218), P12 (= P219), A13 (= A220), E32 (≠ D240), G33 (vs. gap), Q35 (≠ R241), G38 (= G244), A39 (≠ Q245), L40 (≠ V246), T43 (= T249), N48 (= N254), D80 (≠ N284), V81 (≠ Q285), M109 (≠ T315), G110 (= G316), T131 (≠ Y337), C135 (= C341), G274 (= G480), D275 (= D481), R282 (≠ K488), Q283 (= Q489), A284 (≠ I490), A287 (= A493)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R320), H115 (≠ E321), L116 (≠ M322), R173 (≠ F379), E200 (≠ Q406), I201 (≠ T407), I235 (= I442)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
36% identity, 58% coverage: 210:508/520 of query aligns to 3:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V215), G9 (= G216), S10 (≠ A217), G11 (= G218), P12 (= P219), A13 (= A220), E32 (≠ D240), G33 (vs. gap), Q35 (≠ R241), G38 (= G244), A39 (≠ Q245), L40 (≠ V246), T43 (= T249), N48 (= N254), D80 (≠ N284), V81 (≠ Q285), M109 (≠ T315), G110 (= G316), T131 (≠ Y337), C135 (= C341), G274 (= G480), D275 (= D481), R282 (≠ K488), Q283 (= Q489), A284 (≠ I490), A287 (= A493)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ M322), R173 (≠ F379), E200 (≠ Q406), I201 (≠ T407)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
36% identity, 58% coverage: 210:508/520 of query aligns to 3:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G216), S10 (≠ A217), G11 (= G218), P12 (= P219), A13 (= A220), E32 (≠ D240), G33 (vs. gap), Q35 (≠ R241), G38 (= G244), A39 (≠ Q245), L40 (≠ V246), T43 (= T249), N48 (= N254), D80 (≠ N284), V81 (≠ Q285), M109 (≠ T315), G110 (= G316), T131 (≠ Y337), C135 (= C341), G274 (= G480), D275 (= D481), R282 (≠ K488), Q283 (= Q489), A284 (≠ I490), A287 (= A493)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R320), H115 (≠ E321), L116 (≠ M322), V148 (≠ I354), R173 (≠ F379), E200 (≠ Q406), I201 (≠ T407)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
36% identity, 58% coverage: 210:508/520 of query aligns to 3:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ V215), G9 (= G216), S10 (≠ A217), G11 (= G218), P12 (= P219), A13 (= A220), E32 (≠ D240), G33 (vs. gap), Q35 (≠ R241), G38 (= G244), A39 (≠ Q245), L40 (≠ V246), T43 (= T249), N48 (= N254), D80 (≠ N284), V81 (≠ Q285), M109 (≠ T315), G110 (= G316), T131 (≠ Y337), C135 (= C341), G274 (= G480), D275 (= D481), R282 (≠ K488), Q283 (= Q489), A284 (≠ I490), A287 (= A493)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G356), G151 (= G357), D152 (≠ N358), S153 (= S359), E156 (= E362), H172 (≠ E378), R173 (≠ F379), R174 (≠ D380), R178 (= R384), I235 (= I442)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
32% identity, 58% coverage: 210:508/520 of query aligns to 7:305/308 of 3f8rA
- active site: C133 (= C338), C136 (= C341), D137 (= D342)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (= V215), G13 (= G216), L14 (≠ A217), G15 (= G218), P16 (= P219), A17 (= A220), E37 (≠ D240), T38 (≠ R241), G41 (= G244), Q42 (= Q245), I82 (≠ A287), V83 (≠ L288), G109 (≠ A314), I110 (≠ T315), G111 (= G316), R115 (= R320), L117 (≠ M322), D153 (≠ N358), S154 (= S359), E157 (= E362), R174 (≠ F379), R175 (≠ D380), Y184 (≠ L389), I236 (= I442), G275 (= G480), D276 (= D481), L282 (vs. gap), G283 (≠ A486), R285 (≠ K488)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
32% identity, 58% coverage: 210:508/520 of query aligns to 7:307/310 of 3f8pD
- active site: C135 (= C338), C138 (= C341), D139 (= D342)
- binding nicotinamide-adenine-dinucleotide: V12 (= V215), G13 (= G216), L14 (≠ A217), G15 (= G218), P16 (= P219), A17 (= A220), G36 (≠ A239), T38 (≠ R241), G41 (= G244), Q42 (= Q245), I82 (≠ Q285), V83 (≠ K286), G111 (≠ A314), I112 (≠ T315), G113 (= G316), G277 (= G480), D278 (= D481)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
37% identity, 59% coverage: 201:508/520 of query aligns to 1:316/319 of 5u63B
- active site: C139 (= C338), C142 (= C341), D143 (= D342)
- binding flavin-adenine dinucleotide: G16 (= G216), S17 (≠ A217), G18 (= G218), P19 (= P219), A20 (= A220), T39 (≠ A239), G40 (≠ D240), Q42 (≠ R241), G45 (= G244), Q46 (= Q245), L47 (≠ V246), T50 (= T249), N55 (= N254), H87 (≠ G294), I88 (≠ L295), A115 (= A314), T116 (= T315), G117 (= G316), H248 (≠ L444), G288 (= G480), D289 (= D481), R296 (≠ K488), Q297 (= Q489), A298 (≠ I490), S301 (≠ A493)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R320), G157 (= G356), H179 (≠ E378), R180 (≠ F379), R181 (≠ D380), I246 (= I442), G247 (= G443), H248 (≠ L444), R296 (≠ K488)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 57% coverage: 211:508/520 of query aligns to 8:314/321 of P0A9P4
- 36:43 (vs. 239:245, 38% identical) binding
- C136 (= C338) modified: Disulfide link with 139, Redox-active
- C139 (= C341) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 481:490, 40% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
34% identity, 58% coverage: 210:508/520 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (= C338), C136 (= C341), D137 (= D342)
- binding flavin-adenine dinucleotide: G11 (= G216), G13 (= G218), P14 (= P219), A15 (= A220), E34 (≠ A239), R35 (≠ D240), G40 (= G244), Q41 (= Q245), T45 (= T249), N50 (= N254), D81 (≠ K286), I82 (≠ A287), T110 (= T315), G111 (= G316), C136 (= C341), G275 (= G480), D276 (= D481), Q284 (= Q489), I285 (= I490)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ M322), G151 (= G356), G152 (= G357), D153 (≠ N358), S154 (= S359), E157 (= E362), R174 (≠ F379), R175 (≠ D380), R179 (= R384), Q181 (≠ D386), I237 (= I442)
Query Sequence
>6936430 FitnessBrowser__SB2B:6936430
MLNADLKQQLKTYLQNLRQDVRLVVSADDSKKSQELLDLANDISSLSPLVSVTQARLERT
PEMQVTNAQGTDIRFAGLPMGHEFTSLVLALLHTGGHPLKLDMAVIEQIKALPQTLKFET
FISLSCQNCPDVVQALNMMAALNPNVSSTMIDGALFQDEVESRQIMAVPSVFLNGELFSQ
GRISLKEILAKVDTQAAAREADALSEKAPYEVLVVGAGPAGASAAIYSARKGLRTGLVAD
RFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDVMENQKALKLTKDGLYQVEL
ANGAVLSGKTVLIATGARWREMNVPGEKEYRGRGVAYCPHCDGPLFKGKRVAVIGGGNSG
IEAAIDLANIVEHVTVLEFDSKLRADEVLVRKARSMGNIHIITQAQTTEVVGDGNKVTGL
VYTDRATGDVHSVELAGIFVQIGLVPNSEWLKGTLELTPRGEIIVDERGQTSLPGVFAAG
DVTNSAYKQIIIAMGSGATASLGAFDYLIRHSEADASAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory