SitesBLAST
Comparing 6936570 FitnessBrowser__SB2B:6936570 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
67% identity, 99% coverage: 16:1246/1246 of query aligns to 3:1227/1227 of P13009
- C247 (= C259) binding
- C310 (= C322) binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- C311 (= C323) binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- E694 (= E711) binding
- GDVHD 756:760 (= GDVHD 773:777) binding
- D757 (= D774) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H776) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S821) binding
- T808 (= T825) binding
- S810 (= S827) mutation to A: Decreases activity by about 40%.
- A860 (= A877) binding
- D946 (= D964) binding
- R1134 (= R1153) binding
- YY 1189:1190 (≠ YF 1208:1209) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
54% identity, 99% coverage: 6:1244/1246 of query aligns to 8:1263/1265 of Q99707
- R61 (≠ C60) natural variant: R -> K
- C255 (≠ S254) to Y: in dbSNP:rs1140598
- GSR 382:384 (≠ GSA 379:381) binding
- D449 (= D446) binding
- N470 (= N467) binding
- D537 (= D534) binding
- N579 (= N576) binding
- R585 (= R582) binding
- R591 (= R588) binding
- D919 (≠ K910) to G: in dbSNP:rs1805087
- D963 (= D953) mutation to E: Decreases binding to MTRR; when associated with N-1071.
- K1071 (≠ R1054) mutation to N: Decreases binding to MTRR; when associated with E-963.
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
62% identity, 46% coverage: 670:1244/1246 of query aligns to 3:575/576 of 3ivaA
- active site: D107 (= D774), H109 (= H776), S160 (= S827)
- binding cobalamin: H109 (= H776), G112 (= G779), V116 (= V783), G152 (= G819), L153 (≠ M820), S154 (= S821), L156 (= L823), I157 (= I824), T158 (= T825), G183 (= G850), G184 (= G851), Q208 (≠ P875), N209 (≠ D876), T303 (≠ A971), D443 (= D1112), A486 (= A1155), G488 (= G1157), Y489 (= Y1158), H495 (= H1164), A520 (= A1189), M521 (= M1190), G524 (≠ T1193), V527 (= V1196), S528 (= S1197)
- binding s-adenosyl-l-homocysteine: E447 (= E1116), R484 (= R1153), P485 (= P1154), Y489 (= Y1158), A491 (= A1160), Y539 (= Y1208)
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
62% identity, 46% coverage: 670:1244/1246 of query aligns to 3:575/577 of 3bulA
- active site: D107 (= D774), H109 (= H776), S160 (= S827)
- binding cobalamin: H109 (= H776), V116 (= V783), G152 (= G819), L153 (≠ M820), S154 (= S821), L156 (= L823), I157 (= I824), T158 (= T825), G183 (= G850), G184 (= G851), Q208 (≠ P875), N209 (≠ D876), A210 (= A877), T213 (≠ A880), M302 (≠ R970), D443 (= D1112), A486 (= A1155), P487 (= P1156), G488 (= G1157), Y489 (= Y1158), H495 (= H1164), K498 (= K1167), M521 (= M1190), G524 (≠ T1193), V527 (= V1196), S528 (= S1197)
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
56% identity, 51% coverage: 18:653/1246 of query aligns to 3:611/611 of 4cczA
- binding (6s)-5,6,7,8-tetrahydrofolate: E336 (= E373), G342 (= G379), R344 (≠ A381), N430 (= N467), M458 (= M495), D497 (= D534), G536 (= G573), S538 (= S575), N539 (= N576), F542 (= F579), R545 (= R582), R551 (= R588)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
35% identity, 70% coverage: 25:896/1246 of query aligns to 9:841/841 of 8g3hA
- binding cobalamin: Q328 (≠ A364), T330 (≠ S366), S331 (≠ L367), F675 (= F725), V685 (= V735), K693 (= K743), G720 (= G773), V722 (= V775), H723 (= H776), D724 (= D777), I725 (= I778), G726 (= G779), V730 (= V783), M767 (= M820), S768 (= S821), L770 (= L823), V772 (≠ T825), I795 (= I848), L796 (≠ I849), G797 (= G850), G798 (= G851), A799 (= A852), Y818 (= Y873), A819 (≠ I874), E820 (≠ P875), D821 (= D876)
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
60% identity, 26% coverage: 921:1244/1246 of query aligns to 4:325/326 of 6bdyA
1mskA Methionine synthase (activation domain) (see paper)
60% identity, 26% coverage: 921:1244/1246 of query aligns to 4:325/327 of 1mskA
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
67% identity, 23% coverage: 368:656/1246 of query aligns to 4:286/287 of 3k13C
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E9 (= E373), G15 (= G379), R17 (≠ A381), N103 (= N467), D170 (= D534), G209 (= G573), S211 (= S575), N212 (= N576), R218 (= R582), R224 (= R588), I244 (= I608)
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
67% identity, 19% coverage: 670:908/1246 of query aligns to 3:241/246 of 1bmtA
- active site: D107 (= D774), H109 (= H776), S160 (= S827)
- binding co-methylcobalamin: E44 (= E711), M48 (= M715), M51 (= M718), G55 (= G722), L65 (= L732), V68 (= V735), D107 (= D774), V108 (= V775), H109 (= H776), D110 (= D777), I111 (= I778), I115 (= I782), G152 (= G819), L153 (≠ M820), S154 (= S821), L156 (= L823), I157 (= I824), T158 (= T825), G183 (= G850), G184 (= G851), A185 (= A852), V207 (≠ I874), N209 (≠ D876), A210 (= A877)
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
30% identity, 43% coverage: 675:1211/1246 of query aligns to 1:506/507 of 8sseA
- binding cobalamin: H97 (= H776), G100 (= G779), V104 (= V783), S142 (= S821), L145 (≠ I824), V146 (≠ T825), I169 (= I848), G171 (= G850), G172 (= G851), A173 (= A852), H405 (≠ K1108), V409 (≠ D1112), S451 (≠ A1155), F452 (≠ P1156), G453 (= G1157), Y454 (= Y1158), Q463 (≠ K1167), L485 (≠ M1190), E488 (≠ T1193), A490 (= A1195), S492 (= S1197)
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
28% identity, 48% coverage: 18:610/1246 of query aligns to 4:538/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
28% identity, 48% coverage: 18:610/1246 of query aligns to 4:538/559 of 1q8jA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E320 (= E373), D390 (= D446), N411 (= N467), D473 (= D534), G505 (= G573), N508 (= N576), F511 (= F579), R516 (= R588), I536 (= I608)
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
36% identity, 21% coverage: 366:623/1246 of query aligns to 1:252/282 of 5vooA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E7 (= E373), R8 (= R374), G13 (= G379), S14 (= S380), K15 (≠ A381), D77 (= D446), N98 (= N467), D165 (= D534), G204 (= G573), N207 (= N576), F210 (= F579), R217 (= R588), I237 (= I608)
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
32% identity, 16% coverage: 688:889/1246 of query aligns to 14:215/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D774), I105 (≠ V775), H106 (= H776), I108 (= I778), G109 (= G779), V113 (= V783), S150 (≠ M820), S151 (= S821), L153 (= L823), M154 (≠ I824), T155 (= T825), M180 (≠ I848), G182 (= G850), G183 (= G851), G200 (≠ I874), S202 (≠ D876), A203 (= A877)
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
38% identity, 11% coverage: 717:851/1246 of query aligns to 45:174/206 of 4jgiB
- active site: D95 (= D774), H97 (= H776), A148 (≠ S827)
- binding co-methylcobalamin: L63 (≠ V735), D95 (= D774), L96 (≠ V775), H97 (= H776), D98 (= D777), I99 (= I778), G100 (= G779), F104 (≠ V783), G140 (= G819), S142 (= S821), L145 (≠ I824), G173 (= G850), G174 (= G851)
Sites not aligning to the query:
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
34% identity, 14% coverage: 679:856/1246 of query aligns to 38:216/258 of 2i2xB
- active site: D134 (= D774), H136 (= H776), T187 (≠ S827)
- binding 5-hydroxybenzimidazolylcob(iii)amide: G133 (= G773), D134 (= D774), V135 (= V775), H136 (= H776), D137 (= D777), I138 (= I778), G139 (= G779), V143 (= V783), T179 (≠ G819), T181 (≠ S821), L183 (= L823), M184 (≠ I824), T185 (= T825), A208 (≠ I848), G210 (= G850), G211 (= G851), G212 (≠ A852)
Sites not aligning to the query:
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
34% identity, 14% coverage: 679:856/1246 of query aligns to 38:216/258 of Q46EH4
- H129 (≠ V769) mutation to K: Does not affect cobalamin-binding.
- H136 (= H776) mutation H->G,K: Abolishes cobalamin-binding.
Sites not aligning to the query:
- 256:258 HKH→KKK: Does not affect cobalamin-binding.
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
38% identity, 11% coverage: 697:828/1246 of query aligns to 26:156/212 of 3ezxA
- active site: D100 (= D774), H102 (= H776), S155 (= S827)
- binding 5-hydroxybenzimidazolylcobamide: M47 (= M718), F54 (= F725), D100 (= D774), I101 (≠ V775), H102 (= H776), D103 (= D777), I104 (= I778), V109 (= V783), V147 (≠ I818), S149 (= S821), L151 (= L823), M152 (≠ I824), T153 (= T825)
Sites not aligning to the query:
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
39% identity, 10% coverage: 762:888/1246 of query aligns to 3:125/125 of 1y80A
- active site: D15 (= D774), H17 (= H776), T68 (≠ S827)
- binding co-5-methoxybenzimidazolylcobamide: D15 (= D774), L16 (≠ V775), H17 (= H776), D18 (= D777), I19 (= I778), G20 (= G779), V24 (= V783), G60 (= G819), M61 (= M820), S62 (= S821), L64 (= L823), L65 (≠ I824), T66 (= T825), I91 (= I848), G93 (= G850), G94 (= G851), A95 (= A852), P112 (= P875), D113 (= D876), A114 (= A877)
Query Sequence
>6936570 FitnessBrowser__SB2B:6936570
MATPVLSQATKALAQSRQQRLNEDLSTRILILDGAMGTMIQGHKLEEEHYRGSRFADWHC
DVKGNNDLLVLTQPEIIKGIHREYLLAGADIIETNTFNATTVAMADYDMQSLSAEINLVG
ARIAREVADEVEAQTGIPRYVAGVLGPTNRTCSISPDVNDPGYRNIHFDDLVTAYRESTA
ALIEGGADIIMVETIFDTLNAKAALFAIESIFDEVGLRLPVMISGTITDASGRTLTGQTT
EAFYNSLRHIKPISMGLNCALGPKELRPYVEELSRISECYVSAHPNAGLPNEFGGYDETP
KEMADIIVQWAIEGMLNIVGGCCGTTPDHIRVIREAVEKHAPRKLPELPVACRLAGLEPL
TISADSLFVNVGERTNVTGSAKFLKLIKEGQYETALDVARDQVENGAQIIDINMDEGMLD
GEEVMTTFLNLVASEPEISKVPIMIDSSKWEVIEAGLKCVQGKCIVNSISLKEGEAKFIE
QATLVKRYGAAAIIMAFDETGQADTRARKIEICTRAYRILVDKVGFPPEDIIFDPNIFAV
ATGIEEHDNYAVDFIEAVRDIKATLPHAMISGGVSNVSFSFRGNNPVREAIHAVFLYHAI
KEGMDMGIVNAGQLAIYDDIPAELKERVEAVVLNLPCPVEDSTNTEQLLEIAEKYRGGGG
SGAGKKEDLQWRSLPVNKRLEHALVKGITEFIDADTEEARQQATRPLDVIEGPLMDGMNV
VGDLFGEGKMFLPQVVKSARVMKKAVAYLNPFIEAEKVAGQSNGKVLMVTVKGDVHDIGK
NIVGVVLACNGYEVIDLGVMVPVEKIVEVAKKEQVDIIGMSGLITPSLDEMVHNVKTFER
EGLTLPAIIGGATCSKIHTAVKIAPHYPHGAIYIPDASRAVPMVSKLINEETRAATIKAT
YDEYDVMREKRLSQAKRKEIISIEAARENRCQLDWANYQPKVPNKLGIQVFEDYPLDDLV
DRIDWTPFFRAWELHGHFPRILEDEVVGEEARKLFADAKAMLQTIIDEKWLTAKGVIGLF
PANTVNHDDIELYTDESRSQVLMTTHHLRMQIERVGNDNFCLSDFVAPKDSGVVDYTGGF
AVCAGHGIDEHLARFEANHDDYNAIMLKVLADRLAEAFAERMHERVRKEFWGYASDENLD
NEALIREKYRGIRPAPGYPACPDHTEKGLLWDLLKPNECIDLNITESFAMYPTAAVSGWY
FAHPEARYFGVTNIGRDQVEDYARRKGMTVAETEKWLAPILDYDPE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory