Comparing 6936572 FitnessBrowser__SB2B:6936572 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 91% coverage: 9:254/271 of query aligns to 16:265/265 of P07821
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 82% coverage: 5:225/271 of query aligns to 479:701/728 of Q9LVM1
7n5aA Structure of atatm3 in the closed conformation (see paper)
33% identity, 82% coverage: 5:225/271 of query aligns to 352:574/589 of 7n5aA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
33% identity, 82% coverage: 5:225/271 of query aligns to 353:575/590 of 7n59A
Sites not aligning to the query:
Q2G506 ATM1-type heavy metal exporter; ATP-binding cassette transporter Atm1; NaAtm1; EC 7.-.-.- from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199) (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 359:583/608 of Q2G506
Sites not aligning to the query:
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 352:576/600 of 4mrvA
Sites not aligning to the query:
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 352:576/600 of 4mrsA
Sites not aligning to the query:
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 352:576/600 of 4mrpA
Sites not aligning to the query:
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 352:576/600 of 4mrnA
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 338:562/578 of 6parA
6pamA Structure of a bacterial atm1-family abc transporter with mgadp bound (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 347:571/586 of 6pamA
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 79% coverage: 20:234/271 of query aligns to 21:240/343 of P30750
Sites not aligning to the query:
6panA Structure of a bacterial atm1-family abc exporter with atp bound (see paper)
33% identity, 82% coverage: 3:225/271 of query aligns to 329:553/572 of 6panA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 79% coverage: 20:234/271 of query aligns to 22:241/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 79% coverage: 20:234/271 of query aligns to 22:241/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 79% coverage: 20:234/271 of query aligns to 22:241/344 of 3tuiC
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 85% coverage: 5:234/271 of query aligns to 3:233/240 of 6mjpA
4f4cA The crystal structure of the multi-drug transporter (see paper)
34% identity, 81% coverage: 9:227/271 of query aligns to 1025:1249/1250 of 4f4cA
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
35% identity, 74% coverage: 17:217/271 of query aligns to 15:217/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
35% identity, 74% coverage: 17:217/271 of query aligns to 15:217/219 of 8w6iD
Sites not aligning to the query:
>6936572 FitnessBrowser__SB2B:6936572
MTPAIEVSNLCWRVAERPLLDGVSFALSGNGMYGVIGPNGAGKSSLLRCLYRFIRPDSGT
ILLNGQDIHLYSRRSFARAVAVVPQELPALFDLSTEAVVAMGLIPHKGWLAADSAADKVN
IAAALAEVGLEGYGRQPFGKLSGGEKQRALIARALVQKPQFLILDEPTSHLDVRFQIEVL
ELLKRLDICVICTIHDLNLASALCDELLLMSRGRLEASGSPAEVLTETMLASVFGVCTTV
KPHPQHGRPLIHYYYGYNGRTASQEKEEVSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory