Comparing 6936719 FitnessBrowser__SB2B:6936719 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
56% identity, 98% coverage: 3:310/314 of query aligns to 2:308/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 99% coverage: 1:312/314 of query aligns to 52:367/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
30% identity, 86% coverage: 1:271/314 of query aligns to 1:263/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
30% identity, 86% coverage: 1:271/314 of query aligns to 1:263/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
30% identity, 86% coverage: 1:271/314 of query aligns to 1:263/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
30% identity, 86% coverage: 1:271/314 of query aligns to 1:263/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
30% identity, 86% coverage: 1:271/314 of query aligns to 1:263/296 of 1fwkA
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
27% identity, 96% coverage: 1:300/314 of query aligns to 8:285/295 of 6cyzA
4dxlA Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp (see paper)
23% identity, 75% coverage: 33:268/314 of query aligns to 44:264/304 of 4dxlA
Sites not aligning to the query:
2v8pA Ispe in complex with adp and cdp (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 61:184/270 of 2v8pA
Sites not aligning to the query:
2v34B Ispe in complex with cytidine and ligand (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 61:184/270 of 2v34B
Sites not aligning to the query:
2v2vA Ispe in complex with ligand (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 61:184/270 of 2v2vA
Sites not aligning to the query:
2v2qB Ispe in complex with ligand (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 61:184/270 of 2v2qB
Sites not aligning to the query:
2vf3A Aquifex aeolicus ispe in complex with ligand (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 60:183/269 of 2vf3A
Sites not aligning to the query:
2v34A Ispe in complex with cytidine and ligand (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 60:183/269 of 2v34A
Sites not aligning to the query:
2v2zA Ispe in complex with adp and cdpme (see paper)
25% identity, 43% coverage: 64:198/314 of query aligns to 60:183/269 of 2v2zA
Sites not aligning to the query:
>6936719 FitnessBrowser__SB2B:6936719
MSLTVYAPASMGNVGVGFDLLGAALAPIEGSLLGDRVMIAEANAGLTLNTTGAWAHKLPA
NPRENIVWQCAEFFLQRLGKEELGIALTLEKNLPVGSGLGSSASSVVAALYALNEYFDKP
FDEQALLALMGEFEGKISGSVHYDNVAPCYLGGMQLMLDLPGRICESIPSFEHWYWVVAY
PGISLSTAKMRALMPDSYDKSVVIDFGRHLSAFVHASYRQDEALALAVLKDVLAEPYRAP
AIPGYLEARDALAELGMLTSGISGSGPTLFSVTSCLETAEAAKAWLEAHYLTEGGFAHVC
RLDMQGTRVVASEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory