SitesBLAST
Comparing 6936720 FitnessBrowser__SB2B:6936720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
60% identity, 98% coverage: 1:419/428 of query aligns to 1:421/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
33% identity, 89% coverage: 13:395/428 of query aligns to 14:431/464 of 4f4fA
- active site: K113 (= K105)
- binding pyridoxal-5'-phosphate: F112 (= F104), K113 (= K105), T255 (≠ S245), G256 (= G246), N257 (= N247), F258 (= F248), D260 (≠ N250), S308 (≠ A298), M309 (= M299), H387 (= H351), T410 (= T374)
1kl7A Crystal structure of threonine synthase from yeast (see paper)
34% identity, 88% coverage: 13:389/428 of query aligns to 18:461/509 of 1kl7A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
33% identity, 87% coverage: 7:380/428 of query aligns to 11:432/496 of 8g1yA
- binding pyridoxal-5'-phosphate: F113 (= F104), K114 (= K105), D147 (= D134), T268 (≠ S245), G269 (= G246), N270 (= N247), F271 (= F248), N273 (= N250), S322 (≠ A298), H400 (= H351), T426 (= T374)
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 88% coverage: 14:389/428 of query aligns to 18:464/514 of Q42598
- S319 (≠ N289) modified: Phosphoserine
- S321 (≠ T291) modified: Phosphoserine
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
27% identity, 65% coverage: 101:380/428 of query aligns to 124:403/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F104), K128 (= K105), D159 (= D134), G259 (≠ S245), G260 (= G246), N261 (= N247), L262 (≠ F248), G263 (= G249), N264 (= N250), A321 (= A298), H369 (= H351), T397 (= T374)
- binding s-adenosylmethionine: Q246 (= Q230), F247 (≠ Y231)
Sites not aligning to the query:
- binding s-adenosylmethionine: 64, 65, 66, 67, 69, 90, 92, 97, 98, 100, 115, 115
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 65% coverage: 101:380/428 of query aligns to 199:478/526 of Q9S7B5
- L205 (≠ F107) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
Sites not aligning to the query:
- 172 binding
- 173 binding
- 181 binding in monomer B; binding in monomer A
- 187 binding in monomer B
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
25% identity, 65% coverage: 101:380/428 of query aligns to 142:405/448 of 2c2gA
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
28% identity, 63% coverage: 100:369/428 of query aligns to 53:305/345 of 6cgqB
- active site: K58 (= K105), T82 (≠ S132), E214 (≠ A269), S218 (= S273), A236 (= A298)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K105), S81 (≠ T131), T82 (≠ S132), N84 (≠ D134), T85 (= T135), V183 (≠ S245), G184 (= G246), N185 (= N247), A186 (≠ F248), N188 (= N250), A236 (= A298), I237 (≠ M299), E283 (= E349)
- binding phosphate ion: K58 (= K105), T85 (= T135), N151 (= N210), S152 (= S211), R157 (= R216), N185 (= N247)
Sites not aligning to the query:
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
28% identity, 63% coverage: 100:369/428 of query aligns to 55:307/350 of 6nmxA
- active site: K60 (= K105), T84 (≠ S132), E216 (≠ A269), S220 (= S273), A238 (= A298)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K105), S83 (≠ T131), T84 (≠ S132), N86 (≠ D134), T87 (= T135), F133 (= F184), N153 (= N210), S154 (= S211), R159 (= R216), V185 (≠ S245), G186 (= G246), N187 (= N247), A188 (≠ F248), G189 (= G249), N190 (= N250), A238 (= A298), I239 (≠ M299), E285 (= E349)
Sites not aligning to the query:
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
28% identity, 63% coverage: 100:369/428 of query aligns to 51:297/339 of 6cgqA
- active site: K56 (= K105), T80 (≠ S132), E206 (≠ A269), S210 (= S273), A228 (= A298)
- binding pyridoxal-5'-phosphate: F55 (= F104), K56 (= K105), N82 (≠ D134), V175 (≠ S245), G176 (= G246), N177 (= N247), A178 (≠ F248), G179 (= G249), N180 (= N250), A228 (= A298), E275 (= E349)
Sites not aligning to the query:
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 61% coverage: 100:359/428 of query aligns to 64:306/360 of P9WG59
- K69 (= K105) modified: N6-(pyridoxal phosphate)lysine
- N95 (≠ D134) binding
- K151 (≠ Q193) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ GNFGN 246:250) binding
Sites not aligning to the query:
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
27% identity, 61% coverage: 100:359/428 of query aligns to 55:297/349 of 2d1fA
- active site: K60 (= K105), T84 (≠ S132), D209 (= D275), R213 (= R279), L215 (= L281), A240 (= A298)
- binding pyridoxal-5'-phosphate: F59 (= F104), K60 (= K105), N86 (≠ D134), V186 (≠ S245), G187 (= G246), N188 (= N247), A189 (≠ F248), G190 (= G249), N191 (= N250), A240 (= A298)
Sites not aligning to the query:
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
27% identity, 61% coverage: 100:359/428 of query aligns to 64:306/360 of A0R220
- K151 (≠ Q193) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
26% identity, 69% coverage: 100:395/428 of query aligns to 55:335/350 of 3aeyA
- active site: K60 (= K105), T84 (≠ S132), P211 (= P278), G215 (≠ A282), Q217 (≠ A284), A239 (= A298), T316 (= T374)
- binding sulfate ion: K60 (= K105), K60 (= K105), G85 (= G133), N86 (≠ D134), T87 (= T135), T87 (= T135), S154 (= S211), R159 (= R216), N187 (= N247), R228 (vs. gap), V230 (vs. gap), E231 (vs. gap), R232 (vs. gap), A239 (= A298)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
26% identity, 69% coverage: 100:395/428 of query aligns to 56:336/350 of 1uimA
- active site: K61 (= K105), T85 (≠ S132), P212 (= P278), G216 (≠ A282), Q218 (≠ A284), A240 (= A298), T317 (= T374)
- binding pyridoxal-5'-phosphate: F60 (= F104), K61 (= K105), N87 (≠ D134), G187 (= G246), N188 (= N247), A189 (≠ F248), G190 (= G249), N191 (= N250), A240 (= A298), E287 (= E349), T317 (= T374), G318 (≠ A375)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
26% identity, 69% coverage: 100:395/428 of query aligns to 56:336/351 of 3aexA
- active site: K61 (= K105), T85 (≠ S132), P212 (= P278), G216 (≠ A282), Q218 (≠ A284), A240 (= A298), T317 (= T374)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K105), S84 (≠ T131), T85 (≠ S132), N87 (≠ D134), T88 (= T135), V186 (≠ S245), G187 (= G246), N188 (= N247), A189 (≠ F248), G190 (= G249), N191 (= N250), A240 (= A298), I241 (≠ M299), E287 (= E349), T317 (= T374)
- binding phosphate ion: K61 (= K105), T88 (= T135), N154 (= N210), S155 (= S211), R160 (= R216), N188 (= N247)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
26% identity, 69% coverage: 100:395/428 of query aligns to 56:336/351 of 1v7cA
- active site: K61 (= K105), T85 (≠ S132), P212 (= P278), G216 (≠ A282), Q218 (≠ A284), A240 (= A298), T317 (= T374)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K105), S84 (≠ T131), T85 (≠ S132), N87 (≠ D134), T88 (= T135), F134 (= F184), N154 (= N210), S155 (= S211), R160 (= R216), V186 (≠ S245), G187 (= G246), N188 (= N247), A189 (≠ F248), G190 (= G249), N191 (= N250), A240 (= A298), I241 (≠ M299), E287 (= E349), T317 (= T374)
Query Sequence
>6936720 FitnessBrowser__SB2B:6936720
MELYNLKHPDERVSFSQAVKLGLGKDRGLFFPTHIPKLDDVETLLTLPFAQRSKKILGAW
LADELGQNVVDALVDKAFTFEVPLVKVDDTRYCLELFHGPTLAFKDFGARFMAQCLNVLA
GDERLTILTATSGDTGAAVADAFYGLDKVQVCVLYPKGKISLLQEKMFTTLGNNIHTVAV
ESDFDACQALVKQAFDDADVREGLHLNSANSINISRLLAQICYYFEAVAQYRKNFVDAPV
IAVPSGNFGNLTAGFFAKAMGLPVKRFVAATNSNDTVPRYLASANWQVNPTVATMSNAMD
VADPSNWPRVEAIAKVMGWSLAEIDGVALDEQQTRCALLALQEDGYLSEPHAAIAAQALK
ATLGKDERGIFLGTAHPAKFKDVVDHELSLDLPLPPELAAVADKPVLSANLAPDFAALKT
HLFETLRH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory