Comparing 6936759 FitnessBrowser__SB2B:6936759 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
44% identity, 88% coverage: 41:372/377 of query aligns to 44:374/378 of O32445
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
44% identity, 88% coverage: 41:372/377 of query aligns to 45:375/379 of 3iv8A
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
38% identity, 97% coverage: 9:374/377 of query aligns to 8:379/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 97% coverage: 9:374/377 of query aligns to 8:379/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
37% identity, 97% coverage: 9:374/377 of query aligns to 8:379/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
37% identity, 97% coverage: 9:374/377 of query aligns to 8:378/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
37% identity, 97% coverage: 9:374/377 of query aligns to 8:353/356 of 2p50B
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
38% identity, 90% coverage: 33:372/377 of query aligns to 43:381/385 of 6jkuA
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
34% identity, 97% coverage: 9:374/377 of query aligns to 7:331/334 of 1yrrB
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
39% identity, 87% coverage: 47:375/377 of query aligns to 58:397/401 of 7nutA
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
35% identity, 85% coverage: 47:367/377 of query aligns to 54:384/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
35% identity, 85% coverage: 47:367/377 of query aligns to 55:385/396 of O34450
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
32% identity, 93% coverage: 24:375/377 of query aligns to 22:361/363 of 1o12A
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
35% identity, 65% coverage: 46:291/377 of query aligns to 48:293/350 of 6fv3D
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
33% identity, 77% coverage: 46:335/377 of query aligns to 50:342/381 of 6fv4A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
33% identity, 77% coverage: 46:335/377 of query aligns to 50:342/385 of 6fv4B
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
31% identity, 32% coverage: 239:359/377 of query aligns to 248:372/434 of 4f0sA
Sites not aligning to the query:
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
31% identity, 32% coverage: 239:359/377 of query aligns to 248:372/436 of 4f0rA
Sites not aligning to the query:
>6936759 FitnessBrowser__SB2B:6936759
MKTTLIAERLFDGEQFHHNVPLTVEDGQVLALDTVAGCAEVRLQGTLVPGFIDVQVNGGG
GVLFNDTPTVAAIEAIGAAHARFGTTGYLPTLITDKVETMARAADAAAEAIAKGSTGVLG
VHFEGPHLSVPKKGVHPESHIRRIGDRELEIFARQDLGLKVVTLAPENVSPEVICALVDV
GVKVCLGHSNADYATTVAALEAGATGFTHLYNAMSALTSREPGVVGAAIDSDEAWCGLIV
DGHHVHSAAARIAIKAKPRGKVMLVTDAMPPVGMDDNASFELFGIQVVRQGDKLNALTGE
LAGCVLDMAGAVQNTVDMLGLPQAEAIRMASLYPAAFLGIDNRVGTLSVGKQADMVLLDD
NGRCRGTWIGGRQVFGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory