Comparing 6936791 FitnessBrowser__SB2B:6936791 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
5c2xB Crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (tetragonal form) (see paper)
66% identity, 95% coverage: 2:245/257 of query aligns to 1:244/246 of 5c2xB
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
68% identity, 91% coverage: 1:233/257 of query aligns to 1:236/259 of P0A6L0
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
68% identity, 91% coverage: 1:233/257 of query aligns to 2:237/252 of 1jcjA
Sites not aligning to the query:
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
68% identity, 90% coverage: 3:233/257 of query aligns to 1:234/248 of 6z9iB
Sites not aligning to the query:
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
68% identity, 90% coverage: 3:233/257 of query aligns to 1:234/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
68% identity, 90% coverage: 3:233/257 of query aligns to 1:234/248 of 5ekyA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
65% identity, 94% coverage: 4:245/257 of query aligns to 1:245/247 of 7p76A
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
60% identity, 90% coverage: 2:233/257 of query aligns to 1:232/246 of 3q2dA
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
37% identity, 90% coverage: 10:241/257 of query aligns to 49:297/318 of Q9Y315
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
37% identity, 68% coverage: 46:221/257 of query aligns to 35:202/211 of 1ub3A
Sites not aligning to the query:
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
32% identity, 86% coverage: 1:221/257 of query aligns to 1:209/226 of Q4ZMV1
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
27% identity, 93% coverage: 12:250/257 of query aligns to 17:271/273 of 3qyqA
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
30% identity, 81% coverage: 13:221/257 of query aligns to 12:210/222 of 3ngjD
Sites not aligning to the query:
>6936791 FitnessBrowser__SB2B:6936791
MSDLKKAAQRAIELMDLTTLNDDDTAEKVIELCKKAVTPAGHTAAICIYPRFIPIARKTL
IELDAEDIQIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGDETVGFE
LVKACKEACGDDVLLKVIIESGELKDPALIRKASEISIDAGADFIKTSTGKVPVNATLEA
AEIMLTVIAEKNRAVGFKPAGGVRDAAAAAEFLGTAARILGEDWVTPRTFRFGASSLLSS
LLHTLELADAPKGAQGY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory