SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 6936989 FitnessBrowser__SB2B:6936989 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

8j40A Crystal structure of catb8 in complex with chloramphenicol (see paper)
34% identity, 53% coverage: 93:200/204 of query aligns to 54:163/209 of 8j40A

query
sites
8j40A
D
 
D
E
 
K
V
 
L
A
 
I
I
 
I
N
 
G
H
 
S
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
S
G
 
G
R
 
A
V
 
S
G
 
F
I
 
I
N
 
M
I
 
A
G
 
G
S
 
N
R
 
Q
T
 
G
R
 
H
I
 
Q
A
 
H
N
 
D
N
 
W
V
 
A
T
 
S
I
 
S
Y
 
F
A
 
P
F
 
F
N
 
F
H
x
Y
G
 
-
M
 
-
A
 
M
P
 
Q
D
 
E
E
 
E
P
 
P
I
 
A
Y
 
F
T
 
S
Q
 
R
K
 
A
V
 
L
S
 
D
S
 
A
-
 
F
-
 
Q
-
 
R
-
 
A
K
 
G
G
 
D
I
 
T
V
 
V
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
 
I
G
 
G
A
 
S
Q
 
E
A
 
A
G
 
M
I
 
I
V
 
M
D
 
P
G
 
G
V
 
I
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
|
V
V
 
I
G
 
G
M
x
S
G
 
R
A
 
S
I
 
L
V
 
V
T
 
T
R
 
K
D
 
D
V
 
V
A
 
E
P
 
P
Y
 
Y
S
 
A
I
 
I
V
 
I
A
 
G
G
 
G
N
 
N
P
 
P
A
 
A
R
 
K
P
 
Q
I
 
I
G
 
K
D
 
K
R
 
R

Sites not aligning to the query:

2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
35% identity, 53% coverage: 93:200/204 of query aligns to 53:162/208 of 2xatA

query
sites
2xatA
D
 
D
E
 
K
V
 
L
A
 
V
I
 
I
N
 
G
H
 
S
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
S
G
 
G
R
 
A
V
 
A
G
 
F
I
 
I
N
 
M
I
 
A
G
 
G
S
 
N
R
 
Q
T
 
G
R
 
H
I
 
R
A
 
A
N
 
E
N
 
W
V
 
A
T
 
S
I
 
T
Y
 
F
A
 
P
F
 
F
N
 
H
H
 
-
G
 
-
M
 
F
A
 
M
P
 
H
D
 
E
E
 
E
P
 
P
I
 
A
Y
 
F
T
 
A
Q
 
G
K
 
A
V
 
V
S
 
N
-
 
G
-
 
Y
-
 
Q
-
 
P
S
 
A
K
 
G
G
 
D
I
 
T
V
 
L
I
 
I
G
 
G
E
 
H
D
 
E
V
 
V
W
 
W
I
 
I
G
|
G
A
x
T
Q
 
E
A
 
A
G
 
M
I
 
F
V
 
M
D
 
P
G
 
G
V
 
V
T
 
R
I
 
V
G
 
G
N
 
H
H
 
G
A
 
A
V
 
I
V
 
I
G
|
G
M
x
S
G
 
R
A
 
A
I
 
L
V
 
V
T
 
T
R
 
G
D
 
D
V
 
V
A
 
E
P
 
P
Y
 
Y
S
 
A
I
 
I
V
 
V
A
x
G
G
|
G
N
 
N
P
 
P
A
 
A
R
 
R
P
 
T
I
|
I
G
 
R
D
 
K
R
 
R

Sites not aligning to the query:

4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
33% identity, 67% coverage: 62:197/204 of query aligns to 52:181/186 of 4isxA

query
sites
4isxA
E
 
Q
L
 
L
F
 
F
A
 
G
E
 
S
P
 
V
G
 
G
R
 
K
D
 
Q
I
 
I
R
 
N
I
 
V
G
 
E
N
 
Q
Q
 
N
C
 
I
M
 
R
I
 
C
A
 
D
A
 
Y
G
 
G
V
 
Y
F
 
N
I
 
I
H
 
H
G
 
-
P
 
-
V
 
-
E
 
-
M
 
V
G
 
G
D
 
E
E
 
N
V
 
F
A
 
F
I
 
A
N
|
N
H
 
Y
G
 
D
S
 
C
-
 
I
S
 
F
L
 
L
D
 
D
G
 
V
G
 
C
R
 
K
V
 
-
G
 
-
I
 
I
N
 
E
I
 
I
G
 
G
S
 
D
R
 
N
T
 
V
R
 
M
I
 
L
A
|
A
N
 
P
N
 
N
V
 
V
T
 
Q
I
 
I
Y
 
Y
A
 
T
F
 
A
N
 
Y
H
 
H
G
 
-
M
 
-
A
 
-
P
 
-
D
 
-
E
 
-
P
 
P
I
 
I
Y
 
D
T
 
A
Q
 
Q
K
 
L
V
 
R
S
 
N
S
 
S
-
 
G
-
 
I
-
 
E
-
 
Y
-
 
G
K
 
S
G
 
P
I
 
V
V
 
K
I
 
I
G
 
G
E
 
D
D
 
N
V
 
V
W
|
W
I
 
I
G
|
G
A
x
G
Q
 
G
A
 
V
G
 
I
I
 
I
V
 
T
D
 
P
G
 
G
V
 
I
T
 
T
I
 
I
G
 
G
N
 
D
H
 
N
A
 
V
V
 
V
V
 
I
G
 
G
M
x
A
G
 
G
A
 
S
I
 
V
V
 
V
T
 
T
R
 
K
D
 
D
V
 
I
A
 
P
P
 
P
Y
 
N
S
 
T
I
 
V
V
 
A
A
x
V
G
 
G
N
 
N
P
 
P
A
 
C
R
 
R
P
 
V
I
 
I

Sites not aligning to the query:

P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/209 of P50870

query
sites
P50870
I
 
I
Q
 
K
A
 
P
R
 
I
L
 
L
M
 
E
Q
 
K
L
 
L
E
 
E
T
 
N
V
 
V
H
 
E
I
 
V
G
 
G
S
 
E
Q
 
Y
C
 
S
F
 
Y
V
 
Y
-
 
D
A
 
S
P
 
K
E
 
N
A
 
G
E
 
E
L
 
T
F
 
F
A
 
D
E
 
K
P
 
-
G
 
-
R
 
-
D
 
-
I
 
-
R
 
-
I
 
-
G
 
-
N
 
-
Q
 
-
C
 
-
M
 
-
I
 
-
A
 
-
A
 
-
G
 
Q
V
 
I
F
 
L
I
 
Y
H
 
H
G
 
Y
P
 
P
V
 
I
E
 
-
M
 
L
G
 
N
D
 
D
E
 
K
V
 
L
A
 
K
I
 
I
N
 
G
H
 
K
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
P
G
 
G
R
 
V
V
 
T
G
 
I
I
 
I
N
 
M
I
 
N
G
 
G
S
 
A
R
 
N
T
x
H
R
 
R
I
 
M
A
 
D
N
 
G
N
 
-
V
 
-
T
 
S
I
 
T
Y
 
Y
A
 
P
F
 
F
N
 
N
-
 
L
-
 
F
-
 
G
H
 
N
G
 
G
M
 
W
A
 
E
P
 
K
D
 
H
E
 
M
P
 
P
I
 
K
Y
 
L
T
 
D
Q
 
Q
K
 
L
V
 
P
S
 
I
S
 
K
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
 
W
I
 
I
G
 
G
A
 
K
Q
 
D
A
 
V
G
 
V
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
V
G
 
A
M
 
A
G
 
N
A
 
S
I
 
V
V
 
V
T
 
V
R
 
K
D
 
D
V
 
I
A
 
A
P
 
P
Y
 
Y
S
 
M
I
 
L
V
 
A
A
 
G
G
 
G
N
 
N
P
 
P
A
 
A
R
 
N
P
 
E
I
 
I
G
 
K
D
 
Q
R
 
R
R
 
F
D
 
D
K
 
Q

3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/203 of 3dhoA

query
sites
3dhoA
I
 
I
Q
 
K
A
 
P
R
 
I
L
 
L
M
 
E
Q
 
K
L
 
L
E
 
E
T
 
N
V
 
V
H
 
E
I
 
V
G
 
G
S
 
E
Q
 
Y
C
 
S
F
 
Y
V
 
Y
-
 
D
A
 
S
P
 
K
E
 
N
A
 
G
E
 
E
L
 
T
F
 
F
A
 
D
E
 
K
P
 
-
G
 
-
R
 
-
D
 
-
I
 
-
R
 
-
I
 
-
G
 
-
N
 
-
Q
 
-
C
 
-
M
 
-
I
 
-
A
 
-
A
 
-
G
 
Q
V
 
I
F
 
L
I
 
Y
H
 
H
G
 
Y
P
 
P
V
 
I
E
 
-
M
 
L
G
 
N
D
 
D
E
 
K
V
 
L
A
 
K
I
 
I
N
 
G
H
 
K
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
P
G
 
G
R
 
V
V
 
T
G
 
I
I
 
I
N
 
M
I
 
N
G
 
G
S
 
A
R
 
N
T
 
H
R
 
R
I
x
M
A
 
D
N
 
G
N
 
-
V
 
-
T
 
S
I
 
T
Y
 
Y
A
 
P
F
 
F
N
 
N
-
 
L
-
 
F
-
 
G
H
 
N
G
 
G
M
 
W
A
 
E
P
 
K
D
 
H
E
 
M
P
 
P
I
 
K
Y
 
L
T
 
D
Q
 
Q
K
 
L
V
 
P
S
 
I
S
 
K
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
 
W
I
 
I
G
 
G
A
 
K
Q
 
D
A
 
V
G
 
V
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
x
I
V
 
V
G
x
A
M
 
A
G
 
N
A
 
S
I
 
V
V
 
V
T
x
V
R
 
K
D
 
D
V
 
I
A
 
A
P
 
P
Y
 
Y
S
 
M
I
x
L
V
 
A
A
x
G
G
 
G
N
 
N
P
|
P
A
 
A
R
 
N
P
 
E
I
|
I
G
 
K
D
 
Q
R
 
R
R
 
F
D
 
D
K
 
Q

1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/204 of 1mrlA

query
sites
1mrlA
I
 
I
Q
 
K
A
 
P
R
 
I
L
 
L
M
 
E
Q
 
K
L
 
L
E
 
E
T
 
N
V
 
V
H
 
E
I
 
V
G
 
G
S
 
E
Q
 
Y
C
 
S
F
x
Y
V
 
Y
-
x
D
A
 
S
P
 
K
E
 
N
A
 
G
E
 
E
L
 
T
F
 
F
A
 
D
E
 
K
P
 
-
G
 
-
R
 
-
D
 
-
I
 
-
R
 
-
I
 
-
G
 
-
N
 
-
Q
 
-
C
 
-
M
 
-
I
 
-
A
 
-
A
 
-
G
 
Q
V
 
I
F
 
L
I
 
Y
H
 
H
G
x
Y
P
 
P
V
x
I
E
 
-
M
 
L
G
 
N
D
 
D
E
 
K
V
 
L
A
 
K
I
 
I
N
 
G
H
 
K
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
P
G
 
G
R
 
V
V
 
T
G
 
I
I
 
I
N
 
M
I
 
N
G
 
G
S
 
A
R
x
N
T
x
H
R
 
R
I
 
M
A
 
D
N
 
G
N
 
-
V
 
-
T
 
S
I
 
T
Y
 
Y
A
 
P
F
 
F
N
 
N
-
x
L
-
 
F
-
 
G
H
 
N
G
 
G
M
 
W
A
 
E
P
 
K
D
 
H
E
x
M
P
 
P
I
 
K
Y
 
L
T
 
D
Q
 
Q
K
x
L
V
 
P
S
 
I
S
 
K
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
 
W
I
 
I
G
 
G
A
 
K
Q
 
D
A
 
V
G
 
V
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
V
G
 
A
M
 
A
G
 
N
A
 
S
I
 
V
V
 
V
T
 
V
R
 
K
D
 
D
V
 
I
A
 
A
P
 
P
Y
 
Y
S
 
M
I
 
L
V
 
A
A
 
G
G
 
G
N
 
N
P
 
P
A
 
A
R
 
N
P
 
E
I
 
I
G
 
K
D
 
Q
R
 
R
R
 
F
D
 
D
K
 
Q

6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
32% identity, 57% coverage: 84:200/204 of query aligns to 45:162/206 of 6u9cA

query
sites
6u9cA
F
 
Y
I
 
L
H
 
H
G
 
P
P
 
E
V
 
R
E
 
D
M
 
D
G
 
V
D
 
D
E
 
K
V
 
L
A
 
V
I
 
I
N
 
G
H
 
S
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
S
G
 
G
R
 
A
V
 
V
G
 
F
I
 
M
N
 
M
I
 
A
G
 
G
S
 
N
R
 
Q
T
 
G
R
 
H
I
 
R
A
 
S
N
 
D
N
 
W
V
 
I
T
 
S
I
 
T
Y
 
F
A
 
P
F
 
F
-
 
F
-
 
Y
-
 
Q
-
 
D
N
 
N
H
 
D
G
 
N
M
 
F
A
 
A
P
 
D
D
 
A
E
 
R
P
 
D
I
 
G
Y
 
F
T
 
T
Q
 
R
K
 
-
V
 
-
S
 
-
S
 
S
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
H
D
 
D
V
 
V
W
|
W
I
 
I
G
 
G
A
 
T
Q
 
E
A
 
A
G
 
M
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
H
H
 
G
A
 
A
V
 
I
V
 
I
G
x
A
M
 
S
G
 
R
A
 
S
I
 
V
V
 
V
T
 
T
R
 
K
D
 
D
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
E
I
 
V
V
 
V
A
 
G
G
 
S
N
 
N
P
 
P
A
 
A
R
 
K
P
 
H
I
|
I
G
 
K
D
 
F
R
 
R

1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/205 of 1kk4A

query
sites
1kk4A
I
 
I
Q
 
K
A
 
P
R
 
I
L
 
L
M
 
E
Q
 
K
L
 
L
E
 
E
T
 
N
V
 
V
H
 
E
I
 
V
G
 
G
S
 
E
Q
 
Y
C
 
S
F
 
Y
V
 
Y
-
 
D
A
 
S
P
 
K
E
 
N
A
 
G
E
 
E
L
 
T
F
 
F
A
 
D
E
 
K
P
 
-
G
 
-
R
 
-
D
 
-
I
 
-
R
 
-
I
 
-
G
 
-
N
 
-
Q
 
-
C
 
-
M
 
-
I
 
-
A
 
-
A
 
-
G
 
Q
V
 
I
F
 
L
I
 
Y
H
 
H
G
 
Y
P
 
P
V
 
I
E
 
-
M
 
L
G
 
N
D
 
D
E
 
K
V
 
L
A
 
K
I
 
I
N
 
G
H
 
K
G
 
F
S
 
C
S
 
S
L
x
I
D
x
G
G
 
P
G
 
G
R
 
V
V
 
T
G
 
I
I
 
I
N
 
M
I
 
N
G
 
G
S
 
A
R
 
N
T
 
H
R
 
R
I
 
M
A
 
D
N
 
G
N
 
-
V
 
-
T
 
S
I
 
T
Y
 
Y
A
 
P
F
 
F
N
 
N
-
 
L
-
 
F
-
 
G
H
 
N
G
 
G
M
 
W
A
 
E
P
 
K
D
 
H
E
 
M
P
 
P
I
 
K
Y
 
L
T
 
D
Q
 
Q
K
 
L
V
 
P
S
 
I
S
x
K
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
 
I
G
|
G
A
x
K
Q
 
D
A
 
V
G
 
V
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
V
G
x
A
M
x
A
G
 
N
A
 
S
I
 
V
V
 
V
T
x
V
R
x
K
D
 
D
V
 
I
A
 
A
P
 
P
Y
 
Y
S
 
M
I
x
L
V
 
A
A
x
G
G
|
G
N
 
N
P
|
P
A
 
A
R
 
N
P
 
E
I
|
I
G
 
K
D
 
Q
R
 
R
R
 
F
D
 
D
K
 
Q

1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/206 of 1khrA

query
sites
1khrA
I
 
I
Q
 
K
A
 
P
R
 
I
L
 
L
M
 
E
Q
 
K
L
 
L
E
 
E
T
 
N
V
 
V
H
 
E
I
 
V
G
 
G
S
 
E
Q
 
Y
C
 
S
F
x
Y
V
 
Y
-
x
D
A
 
S
P
 
K
E
 
N
A
 
G
E
 
E
L
 
T
F
 
F
A
 
D
E
 
K
P
 
-
G
 
-
R
 
-
D
 
-
I
 
-
R
 
-
I
 
-
G
 
-
N
 
-
Q
 
-
C
 
-
M
 
-
I
 
-
A
 
-
A
 
-
G
 
Q
V
 
I
F
 
L
I
 
Y
H
 
H
G
x
Y
P
 
P
V
 
I
E
 
-
M
 
L
G
 
N
D
 
D
E
 
K
V
 
L
A
 
K
I
 
I
N
 
G
H
 
K
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
P
G
 
G
R
 
V
V
 
T
G
 
I
I
 
I
N
 
M
I
 
N
G
 
G
S
x
A
R
x
N
T
x
H
R
 
R
I
x
M
A
 
D
N
 
G
N
 
-
V
 
-
T
 
S
I
 
T
Y
 
Y
A
 
P
F
 
F
N
 
N
-
x
L
-
 
F
-
 
G
H
 
N
G
 
G
M
 
W
A
 
E
P
 
K
D
 
H
E
 
M
P
 
P
I
 
K
Y
 
L
T
 
D
Q
 
Q
K
 
L
V
 
P
S
 
I
S
 
K
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
 
I
G
 
G
A
 
K
Q
 
D
A
 
V
G
 
V
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
V
G
x
A
M
x
A
G
 
N
A
 
S
I
 
V
V
 
V
T
x
V
R
 
K
D
 
D
V
 
I
A
 
A
P
 
P
Y
 
Y
S
 
M
I
x
L
V
 
A
A
x
G
G
 
G
N
 
N
P
|
P
A
 
A
R
 
N
P
 
E
I
|
I
G
 
K
D
 
Q
R
 
R
R
 
F
D
 
D
K
 
Q

6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
32% identity, 57% coverage: 84:200/204 of query aligns to 48:165/210 of 6pubA

query
sites
6pubA
F
 
Y
I
 
L
H
 
H
G
 
P
P
 
E
V
 
R
E
 
D
M
 
D
G
 
V
D
 
D
E
 
K
V
 
L
A
 
V
I
 
I
N
 
G
H
 
S
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
S
G
 
G
R
 
A
V
 
V
G
 
F
I
 
M
N
 
M
I
 
A
G
 
G
S
 
N
R
 
Q
T
 
G
R
 
H
I
 
R
A
 
S
N
 
D
N
 
W
V
 
I
T
 
S
I
 
T
Y
 
F
A
 
P
F
 
F
-
 
F
-
 
Y
-
 
Q
-
 
D
N
 
N
H
 
D
G
 
N
M
 
F
A
 
A
P
 
D
D
 
A
E
 
R
P
 
D
I
 
G
Y
 
F
T
 
T
Q
 
R
K
 
-
V
 
-
S
 
-
S
 
S
K
 
G
G
 
D
I
 
T
V
 
I
I
 
I
G
 
G
E
 
H
D
 
D
V
 
V
W
 
W
I
 
I
G
 
G
A
 
T
Q
 
E
A
 
A
G
 
M
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
H
H
 
G
A
 
A
V
 
I
V
 
I
G
 
A
M
 
S
G
 
R
A
 
S
I
 
V
V
 
V
T
 
T
R
 
K
D
 
D
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
E
I
 
V
V
 
V
A
 
G
G
 
S
N
 
N
P
 
P
A
 
A
R
 
K
P
 
H
I
 
I
G
 
K
D
 
F
R
 
R

Sites not aligning to the query:

4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/212 of 4husA

query
sites
4husA
M
 
I
G
 
G
D
 
D
E
 
K
V
 
L
A
 
I
I
 
I
N
 
G
H
 
R
G
 
F
S
 
C
S
 
S
L
 
I
D
 
G
G
 
P
G
 
G
R
 
T
V
 
T
G
 
F
I
 
I
N
 
M
I
 
N
G
 
G
S
 
A
R
 
N
T
 
H
R
 
R
I
 
M
-
 
D
A
 
G
N
 
S
N
 
T
V
 
Y
T
 
P
I
 
F
Y
 
H
A
 
L
F
 
F
N
 
R
H
 
M
G
 
G
M
 
W
A
 
E
P
 
K
D
 
Y
E
 
M
P
 
P
I
 
S
Y
 
L
T
 
K
Q
 
D
K
 
L
V
 
P
S
 
L
S
 
K
K
 
G
G
 
D
I
 
I
V
 
E
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
 
W
I
 
I
G
 
G
A
 
R
Q
 
D
A
 
V
G
 
T
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
I
G
 
A
M
 
A
G
 
E
A
 
A
I
 
V
V
 
V
T
 
T
R
 
K
D
 
N
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
S
I
 
I
V
 
V
A
 
G
G
 
G
N
 
N
P
 
P
A
 
L
R
 
K
P
 
F
I
 
I
G
 
R
D
 
K
R
 
R

Sites not aligning to the query:

4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/211 of 4hurA

query
sites
4hurA
M
 
I
G
 
G
D
 
D
E
 
K
V
 
L
A
 
I
I
 
I
N
 
G
H
 
R
G
 
F
S
 
C
S
|
S
L
x
I
D
x
G
G
 
P
G
 
G
R
 
T
V
 
T
G
 
F
I
 
I
N
 
M
I
 
N
G
 
G
S
x
A
R
x
N
T
 
H
R
 
R
I
 
M
-
 
D
A
 
G
N
 
S
N
 
T
V
 
Y
T
 
P
I
 
F
Y
 
H
A
 
L
F
 
F
N
 
R
H
 
M
G
 
G
M
 
W
A
 
E
P
 
K
D
 
Y
E
 
M
P
 
P
I
 
S
Y
 
L
T
 
K
Q
 
D
K
 
L
V
 
P
S
 
L
S
x
K
K
 
G
G
 
D
I
 
I
V
 
E
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
|
I
G
|
G
A
x
R
Q
 
D
A
 
V
G
 
T
I
 
I
V
x
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
I
G
x
A
M
x
A
G
 
E
A
 
A
I
 
V
V
 
V
T
|
T
R
 
K
D
 
N
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
S
I
 
I
V
 
V
A
x
G
G
 
G
N
 
N
P
|
P
A
 
L
R
 
K
P
 
F
I
|
I
G
x
R
D
 
K
R
 
R

Sites not aligning to the query:

6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/207 of 6x3cA

query
sites
6x3cA
M
 
I
G
 
G
D
 
D
E
 
K
V
 
L
A
 
I
I
 
I
N
 
G
H
 
R
G
 
F
S
 
C
S
 
S
L
 
I
D
x
G
G
 
P
G
 
G
R
 
T
V
 
T
G
 
F
I
 
I
N
 
M
I
 
N
G
|
G
S
 
A
R
x
N
T
x
H
R
 
R
I
 
M
-
 
D
A
 
G
N
 
S
N
 
T
V
 
Y
T
 
P
I
 
F
Y
x
H
A
x
L
F
 
F
N
 
R
H
 
M
G
 
G
M
 
W
A
 
E
P
 
K
D
 
Y
E
x
M
P
|
P
I
 
S
Y
x
L
T
 
K
Q
 
D
K
 
L
V
 
P
S
 
L
S
 
K
K
 
G
G
 
D
I
 
I
V
 
E
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
 
I
G
|
G
A
x
R
Q
 
D
A
 
V
G
 
T
I
 
I
V
x
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
I
G
x
A
M
x
A
G
 
E
A
 
A
I
 
V
V
 
V
T
 
T
R
 
K
D
 
N
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
S
I
 
I
V
 
V
A
 
G
G
 
G
N
 
N
P
 
P
A
 
L
R
 
K
P
 
F
I
 
I
G
 
R
D
 
K
R
 
R

Sites not aligning to the query:

6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/206 of 6x3jA

query
sites
6x3jA
M
 
I
G
 
G
D
 
D
E
 
K
V
 
L
A
 
I
I
 
I
N
 
G
H
 
R
G
 
F
S
 
C
S
 
S
L
 
I
D
x
G
G
 
P
G
 
G
R
 
T
V
 
T
G
 
F
I
 
I
N
 
M
I
 
N
G
 
G
S
x
A
R
 
N
T
x
H
R
 
R
I
 
M
-
 
D
A
 
G
N
 
S
N
 
T
V
 
Y
T
 
P
I
 
F
Y
x
H
A
x
L
F
 
F
N
 
R
H
 
M
G
 
G
M
 
W
A
 
E
P
 
K
D
 
Y
E
x
M
P
|
P
I
 
S
Y
 
L
T
 
K
Q
 
D
K
x
L
V
 
P
S
 
L
S
 
K
K
 
G
G
 
D
I
 
I
V
 
E
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
 
I
G
|
G
A
 
R
Q
 
D
A
 
V
G
 
T
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
I
G
 
A
M
 
A
G
 
E
A
 
A
I
 
V
V
 
V
T
 
T
R
 
K
D
 
N
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
S
I
 
I
V
 
V
A
 
G
G
 
G
N
 
N
P
 
P
A
 
L
R
 
K
P
 
F
I
 
I
G
 
R
D
 
K
R
 
R

Sites not aligning to the query:

6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/203 of 6x3cE

query
sites
6x3cE
M
 
I
G
 
G
D
 
D
E
 
K
V
 
L
A
 
I
I
 
I
N
 
G
H
 
R
G
 
F
S
 
C
S
 
S
L
 
I
D
x
G
G
 
P
G
 
G
R
 
T
V
 
T
G
 
F
I
 
I
N
 
M
I
 
N
G
|
G
S
 
A
R
x
N
T
x
H
R
 
R
I
x
M
-
 
D
A
 
G
N
 
S
N
 
T
V
 
Y
T
 
P
I
 
F
Y
x
H
A
x
L
F
 
F
N
 
R
H
 
M
G
 
G
M
 
W
A
 
E
P
 
K
D
 
Y
E
x
M
P
|
P
I
 
S
Y
 
L
T
 
K
Q
 
D
K
 
L
V
 
P
S
 
L
S
 
K
K
 
G
G
 
D
I
 
I
V
 
E
I
 
I
G
 
G
E
 
N
D
 
D
V
 
V
W
|
W
I
 
I
G
|
G
A
 
R
Q
 
D
A
 
V
G
 
T
I
 
I
V
 
M
D
 
P
G
 
G
V
 
V
T
 
K
I
 
I
G
 
G
N
 
D
H
 
G
A
 
A
V
 
I
V
 
I
G
x
A
M
x
A
G
 
E
A
 
A
I
 
V
V
 
V
T
 
T
R
 
K
D
 
N
V
 
V
A
 
A
P
 
P
Y
 
Y
S
 
S
I
 
I
V
 
V
A
 
G
G
 
G
N
|
N
P
|
P
A
 
L
R
 
K
P
 
F
I
 
I
G
 
R
D
 
K
R
 
R

Sites not aligning to the query:

3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
31% identity, 75% coverage: 50:202/204 of query aligns to 53:183/183 of 3nz2C

query
sites
3nz2C
H
 
H
I
 
L
G
 
G
S
 
H
Q
 
K
C
 
S
F
 
C
V
 
V
A
 
Q
P
 
P
E
 
P
A
 
-
E
 
-
L
 
F
F
 
H
A
 
C
E
 
E
P
 
F
G
 
G
R
 
K
D
 
T
I
 
I
R
 
R
I
 
I
G
 
G
N
 
D
Q
 
H
C
 
T
M
 
F
I
 
I
A
 
N
A
 
M
G
 
N
V
 
V
F
 
V
I
 
M
H
 
-
G
 
-
P
 
-
V
 
-
E
 
-
M
 
-
G
 
-
D
 
-
E
 
-
V
 
-
A
 
-
I
 
-
N
 
-
H
 
-
G
 
-
S
 
-
S
 
-
L
 
L
D
 
D
G
 
G
G
 
A
R
 
-
V
 
-
G
 
P
I
 
I
N
 
T
I
 
I
G
 
G
S
 
D
R
 
H
T
 
V
R
 
L
I
 
I
A
 
G
N
 
P
N
 
S
V
 
T
T
 
Q
I
 
F
Y
|
Y
A
 
T
F
 
A
N
 
S
H
|
H
G
 
S
M
 
L
A
 
D
P
 
-
D
 
-
E
 
-
P
 
-
I
 
-
Y
 
Y
T
 
R
Q
 
R
K
 
R
V
 
Q
S
 
A
-
 
W
-
 
E
-
 
T
-
 
I
S
 
C
K
 
K
G
 
P
I
 
I
V
 
V
I
 
I
G
 
E
E
 
D
D
 
D
V
 
V
W
 
W
I
 
I
G
|
G
A
 
G
Q
 
N
A
 
V
G
 
V
I
 
I
V
 
N
D
 
Q
G
 
G
V
 
V
T
 
T
I
 
I
G
 
G
N
 
A
H
 
R
A
 
S
V
 
V
V
 
V
G
x
A
M
x
A
G
x
N
A
 
S
I
 
V
V
 
V
T
x
N
R
 
Q
D
 
D
V
 
V
A
 
P
P
 
P
Y
 
D
S
 
T
I
 
L
V
 
V
A
x
G
G
 
G
N
x
T
P
|
P
A
 
A
R
 
R
P
 
I
I
x
L
G
x
R
D
 
S
R
 
L
R
 
K
D
 
D

3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
31% identity, 75% coverage: 50:202/204 of query aligns to 46:176/176 of 3ectA

query
sites
3ectA
H
 
H
I
 
L
G
 
G
S
 
H
Q
 
K
C
 
S
F
 
C
V
 
V
A
 
Q
P
 
P
E
 
P
A
 
-
E
 
-
L
 
F
F
 
H
A
 
C
E
 
E
P
 
F
G
 
G
R
 
K
D
 
T
I
 
I
R
 
R
I
 
I
G
 
G
N
 
D
Q
 
H
C
 
T
M
 
F
I
 
I
A
 
N
A
 
M
G
 
N
V
 
V
F
 
V
I
 
M
H
 
-
G
 
-
P
 
-
V
 
-
E
 
-
M
 
-
G
 
-
D
 
-
E
 
-
V
 
-
A
 
-
I
 
-
N
 
-
H
 
-
G
 
-
S
 
-
S
 
-
L
 
L
D
 
D
G
 
G
G
 
A
R
 
-
V
 
-
G
 
P
I
 
I
N
 
T
I
 
I
G
 
G
S
 
D
R
 
H
T
 
V
R
 
L
I
 
I
A
 
G
N
 
P
N
 
S
V
 
T
T
 
Q
I
 
F
Y
 
Y
A
 
T
F
 
A
N
 
S
H
 
H
G
 
S
M
 
L
A
 
D
P
 
-
D
 
-
E
 
-
P
 
-
I
 
-
Y
 
Y
T
 
R
Q
 
R
K
 
R
V
 
Q
S
 
A
-
 
W
-
 
E
-
 
T
-
 
I
S
 
C
K
 
K
G
 
P
I
 
I
V
 
V
I
 
I
G
 
E
E
 
D
D
 
D
V
 
V
W
 
W
I
 
I
G
 
G
A
 
G
Q
 
N
A
 
V
G
 
V
I
 
I
V
 
N
D
 
Q
G
|
G
V
 
V
T
 
T
I
 
I
G
 
G
N
 
A
H
 
R
A
 
S
V
 
V
V
 
V
G
 
A
M
 
A
G
 
N
A
 
S
I
 
V
V
 
V
T
 
N
R
 
Q
D
|
D
V
 
V
A
 
P
P
 
P
Y
 
D
S
 
T
I
 
L
V
 
V
A
 
G
G
 
G
N
 
T
P
 
P
A
 
A
R
 
R
P
 
I
I
 
L
G
 
R
D
 
S
R
 
L
R
 
K
D
 
D

3vbkC Crystal structure of the s84a mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a (see paper)
29% identity, 80% coverage: 40:203/204 of query aligns to 7:174/186 of 3vbkC

query
sites
3vbkC
Q
 
Q
A
 
E
R
 
E
L
 
L
M
 
K
Q
 
K
L
 
I
E
 
G
T
 
F
V
 
L
H
 
S
I
 
V
G
 
G
S
 
K
Q
 
N
C
 
V
F
 
L
V
 
I
A
 
S
P
 
K
E
 
K
A
 
A
E
 
S
L
 
I
F
x
Y
A
 
-
E
 
N
P
 
P
G
 
G
R
 
V
D
 
-
I
 
I
R
 
S
I
 
I
G
 
G
N
 
N
Q
 
N
C
 
V
M
x
R
I
 
I
A
x
D
A
x
D
G
 
F
V
 
C
F
 
I
I
 
L
H
x
S
G
 
G
P
 
K
V
 
V
E
 
T
M
 
I
G
 
G
D
 
S
E
 
Y
V
 
S
A
x
H
I
 
I
N
 
A
H
 
A
G
 
Y
S
 
T
S
 
A
L
 
L
D
 
Y
G
 
G
G
 
G
R
 
E
V
 
V
G
 
G
I
 
I
-
 
E
-
 
M
-
 
Y
-
 
D
-
 
F
-
 
A
N
 
N
I
|
I
G
 
A
S
 
S
R
 
R
T
 
T
R
 
I
I
 
V
A
x
Y
N
 
A
N
x
A
V
x
I
T
 
D
I
 
D
Y
x
F
A
 
S
F
 
G
N
 
N
H
 
A
G
 
L
M
 
M
A
 
G
P
 
P
D
 
T
E
 
I
P
 
P
I
 
N
Y
 
Q
T
 
Y
Q
 
K
K
 
N
V
 
V
S
 
K
S
 
T
K
 
G
G
 
K
I
 
V
V
 
I
I
 
L
G
 
K
E
 
K
D
 
H
V
 
V
W
 
I
I
 
I
G
 
G
A
 
A
Q
 
H
A
 
S
G
 
I
I
 
I
V
x
F
D
 
P
G
 
N
V
 
V
T
 
V
I
 
I
G
 
G
N
 
E
H
 
G
A
 
V
V
 
A
V
 
V
G
|
G
M
x
A
G
 
M
A
 
S
I
x
M
V
 
V
T
x
K
R
 
E
D
 
S
V
 
L
A
 
D
P
 
D
Y
 
W
S
 
Y
I
 
I
V
 
Y
A
x
V
G
 
G
N
x
V
P
 
P
A
 
V
R
 
R
P
 
K
I
 
I
G
 
K
D
 
A
R
 
R
R
 
K
D
 
R
K
 
K

Sites not aligning to the query:

3vbjA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp and 3-hydroxybutyryl-coa (see paper)
29% identity, 80% coverage: 40:203/204 of query aligns to 7:174/186 of 3vbjA

query
sites
3vbjA
Q
 
Q
A
 
E
R
 
E
L
 
L
M
 
K
Q
 
K
L
 
I
E
 
G
T
 
F
V
 
L
H
 
S
I
 
V
G
 
G
S
 
K
Q
 
N
C
 
V
F
 
L
V
 
I
A
 
S
P
 
K
E
 
K
A
 
A
E
 
S
L
 
I
F
x
Y
A
 
-
E
 
N
P
 
P
G
 
G
R
 
V
D
 
-
I
 
I
R
 
S
I
 
I
G
 
G
N
 
N
Q
 
N
C
 
V
M
x
R
I
 
I
A
x
D
A
x
D
G
 
F
V
 
C
F
 
I
I
 
L
H
x
S
G
 
G
P
 
K
V
 
V
E
 
T
M
 
I
G
 
G
D
 
S
E
 
Y
V
 
S
A
x
H
I
 
I
N
 
A
H
 
A
G
 
Y
S
 
T
S
 
A
L
 
L
D
 
Y
G
 
G
G
 
G
R
 
E
V
 
V
G
 
G
I
 
I
-
 
E
-
 
M
-
 
Y
-
 
D
-
 
F
-
 
A
N
 
N
I
|
I
G
x
S
S
 
S
R
 
R
T
 
T
R
 
I
I
 
V
A
x
Y
N
 
A
N
 
A
V
 
I
T
x
D
I
 
D
Y
x
F
A
 
S
F
 
G
N
 
N
H
 
A
G
 
L
M
 
M
A
 
G
P
 
P
D
 
T
E
 
I
P
 
P
I
 
N
Y
 
Q
T
 
Y
Q
 
K
K
 
N
V
 
V
S
 
K
S
 
T
K
 
G
G
 
K
I
 
V
V
 
I
I
 
L
G
 
K
E
 
K
D
 
H
V
 
V
W
 
I
I
 
I
G
 
G
A
 
A
Q
 
H
A
 
S
G
 
I
I
 
I
V
x
F
D
 
P
G
 
N
V
 
V
T
 
V
I
 
I
G
 
G
N
 
E
H
 
G
A
 
V
V
 
A
V
 
V
G
|
G
M
x
A
G
 
M
A
 
S
I
 
M
V
 
V
T
x
K
R
 
E
D
 
S
V
 
L
A
 
D
P
 
D
Y
 
W
S
 
Y
I
 
I
V
 
Y
A
x
V
G
 
G
N
x
V
P
 
P
A
 
V
R
 
R
P
 
K
I
 
I
G
x
K
D
 
A
R
 
R
R
 
K
D
 
R
K
 
K

Sites not aligning to the query:

3vbiA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a (see paper)
29% identity, 80% coverage: 40:203/204 of query aligns to 7:174/186 of 3vbiA

query
sites
3vbiA
Q
 
Q
A
 
E
R
 
E
L
 
L
M
 
K
Q
 
K
L
 
I
E
 
G
T
 
F
V
 
L
H
 
S
I
 
V
G
 
G
S
 
K
Q
 
N
C
 
V
F
 
L
V
 
I
A
 
S
P
 
K
E
 
K
A
 
A
E
 
S
L
 
I
F
x
Y
A
 
-
E
 
N
P
 
P
G
 
G
R
 
V
D
 
-
I
 
I
R
 
S
I
 
I
G
 
G
N
 
N
Q
 
N
C
 
V
M
x
R
I
 
I
A
x
D
A
x
D
G
 
F
V
 
C
F
 
I
I
 
L
H
x
S
G
 
G
P
 
K
V
 
V
E
 
T
M
 
I
G
 
G
D
 
S
E
 
Y
V
 
S
A
x
H
I
 
I
N
 
A
H
 
A
G
 
Y
S
 
T
S
 
A
L
 
L
D
x
Y
G
 
G
G
 
G
R
 
E
V
 
V
G
 
G
I
 
I
-
 
E
-
 
M
-
 
Y
-
 
D
-
 
F
-
 
A
N
 
N
I
 
I
G
x
S
S
 
S
R
 
R
T
 
T
R
 
I
I
 
V
A
x
Y
N
 
A
N
x
A
V
x
I
T
x
D
I
 
D
Y
x
F
A
 
S
F
 
G
N
 
N
H
 
A
G
 
L
M
 
M
A
 
G
P
 
P
D
 
T
E
 
I
P
 
P
I
 
N
Y
 
Q
T
 
Y
Q
 
K
K
 
N
V
 
V
S
 
K
S
 
T
K
 
G
G
 
K
I
 
V
V
 
I
I
 
L
G
 
K
E
 
K
D
 
H
V
 
V
W
 
I
I
 
I
G
 
G
A
 
A
Q
 
H
A
 
S
G
 
I
I
 
I
V
x
F
D
 
P
G
 
N
V
 
V
T
 
V
I
 
I
G
 
G
N
 
E
H
 
G
A
 
V
V
 
A
V
 
V
G
|
G
M
x
A
G
 
M
A
 
S
I
 
M
V
 
V
T
x
K
R
 
E
D
 
S
V
 
L
A
 
D
P
 
D
Y
 
W
S
 
Y
I
 
I
V
 
Y
A
x
V
G
 
G
N
x
V
P
 
P
A
 
V
R
 
R
P
 
K
I
 
I
G
x
K
D
 
A
R
 
R
R
 
K
D
 
R
K
 
K

Sites not aligning to the query:

Query Sequence

>6936989 FitnessBrowser__SB2B:6936989
MTADDFREQHKKRLSWMPWLYFSLKDKHKAWALPWQADIQARLMQLETVHIGSQCFVAPE
AELFAEPGRDIRIGNQCMIAAGVFIHGPVEMGDEVAINHGSSLDGGRVGINIGSRTRIAN
NVTIYAFNHGMAPDEPIYTQKVSSKGIVIGEDVWIGAQAGIVDGVTIGNHAVVGMGAIVT
RDVAPYSIVAGNPARPIGDRRDKR

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory