SitesBLAST
Comparing 6936989 FitnessBrowser__SB2B:6936989 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
35% identity, 53% coverage: 93:200/204 of query aligns to 53:162/208 of 2xatA
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
33% identity, 67% coverage: 62:197/204 of query aligns to 52:181/186 of 4isxA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/209 of P50870
- H82 (≠ T116) mutation to A: 105-fold decrease in activity.
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/203 of 3dhoA
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: Y37 (≠ F56), D39 (vs. gap), Y54 (≠ G87), I56 (≠ V89), N81 (≠ R115), H82 (≠ T116), L93 (vs. gap), M102 (≠ E135), L108 (≠ K141)
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
32% identity, 57% coverage: 84:200/204 of query aligns to 45:162/206 of 6u9cA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/205 of 1kk4A
- binding acetyl coenzyme *a: I69 (≠ L103), G70 (≠ D104), K111 (≠ S144), W121 (= W154), G123 (= G156), K124 (≠ A157), A141 (≠ G174), A142 (≠ M175), V147 (≠ T180), K148 (≠ R181), L155 (≠ I188), G157 (≠ A190), G158 (= G191), P160 (= P193), I164 (= I197)
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
29% identity, 81% coverage: 39:203/204 of query aligns to 20:170/206 of 1khrA
- binding coenzyme a: H82 (≠ T116), M84 (≠ I118), W121 (= W154), A141 (≠ G174), A142 (≠ M175), V147 (≠ T180), L155 (≠ I188), G157 (≠ A190), P160 (= P193), I164 (= I197)
- binding virginiamycin m1: Y37 (≠ F56), D39 (vs. gap), Y54 (≠ G87), A80 (≠ S114), N81 (≠ R115), H82 (≠ T116), L93 (vs. gap)
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
32% identity, 57% coverage: 84:200/204 of query aligns to 48:165/210 of 6pubA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/211 of 4hurA
- binding acetyl coenzyme *a: S67 (= S102), I68 (≠ L103), G69 (≠ D104), A79 (≠ S114), N80 (≠ R115), K110 (≠ S144), W120 (= W154), I121 (= I155), G122 (= G156), R123 (≠ A157), M128 (≠ V162), A140 (≠ G174), A141 (≠ M175), T146 (= T180), G156 (≠ A190), P159 (= P193), I163 (= I197), R164 (≠ G198)
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (= G113), N80 (≠ R115), H81 (≠ T116), H91 (≠ Y125), L92 (≠ A126), M101 (≠ E135), P102 (= P136), L104 (≠ Y138)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ D104), N80 (≠ R115), H81 (≠ T116), W120 (= W154), G122 (= G156), R123 (≠ A157), M128 (≠ V162), A140 (≠ G174), A141 (≠ M175)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: H91 (≠ Y125), L92 (≠ A126), M101 (≠ E135), P102 (= P136), L107 (≠ K141)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ D104), A79 (≠ S114), H81 (≠ T116), W120 (= W154), G122 (= G156)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53, 55
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 54% coverage: 91:200/204 of query aligns to 56:166/203 of 6x3cE
- binding magnesium ion: N158 (= N192), P159 (= P193)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (= G113), N80 (≠ R115), H81 (≠ T116), H91 (≠ Y125), L92 (≠ A126), M101 (≠ E135), P102 (= P136)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ D104), H81 (≠ T116), M83 (≠ I118), W120 (= W154), G122 (= G156), A140 (≠ G174), A141 (≠ M175)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
31% identity, 75% coverage: 50:202/204 of query aligns to 53:183/183 of 3nz2C
- binding acetyl coenzyme *a: Y107 (= Y125), H111 (= H129), G137 (= G156), A155 (≠ G174), A156 (≠ M175), N161 (≠ T180), G171 (≠ A190), T173 (≠ N192), P174 (= P193), L178 (≠ I197), R179 (≠ G198)
- binding magnesium ion: N157 (≠ G176), T173 (≠ N192)
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
31% identity, 75% coverage: 50:202/204 of query aligns to 46:176/176 of 3ectA
3vbkC Crystal structure of the s84a mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a (see paper)
29% identity, 80% coverage: 40:203/204 of query aligns to 7:174/186 of 3vbkC
- binding dTDP-4-amino-4,6-dideoxyglucose: Y31 (≠ F64), R43 (≠ M78), D45 (≠ A80), D46 (≠ A81), S51 (≠ H86), H61 (≠ A96), A92 (≠ N121)
- binding bicarbonate ion: H61 (≠ A96), I83 (= I112)
- binding coenzyme a: Y90 (≠ A119), I93 (≠ V122), F96 (≠ Y125), F133 (≠ V162), G145 (= G174), A146 (≠ M175), M149 (≠ I178), K151 (≠ T180), V161 (≠ A190), V163 (≠ N192)
Sites not aligning to the query:
3vbjA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp and 3-hydroxybutyryl-coa (see paper)
29% identity, 80% coverage: 40:203/204 of query aligns to 7:174/186 of 3vbjA
- binding 3-hydroxybutanoyl-coenzyme a: H61 (≠ A96), I83 (= I112), S84 (≠ G113), Y90 (≠ A119), D94 (≠ T123), F96 (≠ Y125), F133 (≠ V162), G145 (= G174), A146 (≠ M175), K151 (≠ T180), V161 (≠ A190), V163 (≠ N192), K169 (≠ G198)
- binding thymidine-5'-diphosphate: Y31 (≠ F64), R43 (≠ M78), D45 (≠ A80), D46 (≠ A81), S51 (≠ H86)
Sites not aligning to the query:
3vbiA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a (see paper)
29% identity, 80% coverage: 40:203/204 of query aligns to 7:174/186 of 3vbiA
- binding dTDP-4-amino-4,6-dideoxyglucose: Y31 (≠ F64), R43 (≠ M78), D45 (≠ A80), D46 (≠ A81), S51 (≠ H86), H61 (≠ A96), Y69 (≠ D104), A92 (≠ N121), D94 (≠ T123)
- binding coenzyme a: S84 (≠ G113), Y90 (≠ A119), I93 (≠ V122), F96 (≠ Y125), F133 (≠ V162), G145 (= G174), A146 (≠ M175), K151 (≠ T180), V161 (≠ A190), V163 (≠ N192), K169 (≠ G198)
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 46% coverage: 110:203/204 of query aligns to 96:188/203 of P07464
- H115 (= H129) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ A157) binding in other chain
- A160 (≠ M175) binding in other chain
- TK 165:166 (≠ TR 180:181) binding
- R180 (= R195) binding
- R183 (≠ G198) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
- 71 binding
- 85 binding in other chain; binding in other chain
- 93 binding
Query Sequence
>6936989 FitnessBrowser__SB2B:6936989
MTADDFREQHKKRLSWMPWLYFSLKDKHKAWALPWQADIQARLMQLETVHIGSQCFVAPE
AELFAEPGRDIRIGNQCMIAAGVFIHGPVEMGDEVAINHGSSLDGGRVGINIGSRTRIAN
NVTIYAFNHGMAPDEPIYTQKVSSKGIVIGEDVWIGAQAGIVDGVTIGNHAVVGMGAIVT
RDVAPYSIVAGNPARPIGDRRDKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory