Comparing 6937015 FitnessBrowser__SB2B:6937015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O74478 Probable phosphoribomutase; PRM; Phosphoglucomutase 3 homolog; PGM 3 homolog; EC 5.4.2.7 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 94% coverage: 1:548/585 of query aligns to 1:550/587 of O74478
P18159 Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 from Bacillus subtilis (strain 168) (see paper)
37% identity, 93% coverage: 32:573/585 of query aligns to 29:571/581 of P18159
Q96G03 Phosphopentomutase; Glucose phosphomutase 2; Phosphodeoxyribomutase; Phosphoglucomutase-2; EC 5.4.2.7; EC 5.4.2.2 from Homo sapiens (Human) (see 2 papers)
35% identity, 95% coverage: 2:554/585 of query aligns to 12:575/612 of Q96G03
Sites not aligning to the query:
Q03262 Phosphoribomutase; PRM; Phosphoglucomutase 3; PGM 3; EC 5.4.2.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 92% coverage: 12:550/585 of query aligns to 20:586/622 of Q03262
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
31% identity, 58% coverage: 43:381/585 of query aligns to 2:308/455 of 1wqaA
Sites not aligning to the query:
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6nqhA
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6np8A
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6nolA
Sites not aligning to the query:
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6nnpA
Sites not aligning to the query:
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6nn2A
Sites not aligning to the query:
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6n1eA
Sites not aligning to the query:
6mnvA Crystal structure of x. Citri phosphoglucomutase in complex with ch2fg1p (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6mnvA
Sites not aligning to the query:
6mlhA Crystal structure of x. Citri phosphoglucomutase in complex with glucopyranosyl-1-methyl-phosphonic acid (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6mlhA
Sites not aligning to the query:
6mlfA Crystal structure of x. Citri phosphoglucomutase in complex with 6- fluoro glucose 1-phosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 6mlfA
Sites not aligning to the query:
5kl0A Crystal structure of phosphoglucomutase from xanthomonas citri citri complexed with glucose-1,6-biphosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 5:275/448 of 5kl0A
Sites not aligning to the query:
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 6:276/449 of 6mlwA
Sites not aligning to the query:
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
30% identity, 52% coverage: 46:351/585 of query aligns to 6:276/449 of 5bmpA
Sites not aligning to the query:
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
23% identity, 63% coverage: 47:412/585 of query aligns to 6:334/455 of 2h5aX
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
23% identity, 63% coverage: 47:412/585 of query aligns to 6:334/455 of 2h4lX
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
23% identity, 63% coverage: 47:412/585 of query aligns to 6:334/455 of 2fkfA
Sites not aligning to the query:
>6937015 FitnessBrowser__SB2B:6937015
MDTQLAFKVKHWLARDPDAKSRAALEALVAAGDDRALEAAFDGRLAFGTAGIRGIVGPGP
MGMNRLLVRETSAGLGAYLEAQIKDAKRRGLVIGFDGRHDSRVFAHDAACVLSAMGFKVR
LTSHVAPTPLVAFGVKHFEAAAGIVVTASHNPPKYNGYKVYWENGAQIIPPHDAGIAACI
DRAANLELPWMPEPEAVKQGRLSFLQDDFFERYRRAILHSPLLHPAGESQAGRASLGIAY
TAMHGVGAPMAERVLRDAGFSQVYSVAAQREPDGNFPTVNFPNPEEPGAMDMVIAEAGDK
GALLACANDPDADRFALAARQSDGGYRMLSGDQTGALLCDYLLSHWQGAGVPLVGNTIVS
SALLHAIAAHYGAHSYTTLTGFKWLMNTAQQLETPQQPFLFAYEEALGYTVGNLVWDKDG
ISAQLCFANLAAELLAEGKDVWAALERLYRRHGLYVNRQVSIALGEGTPDIGAWLRDNPP
TEIDKRPVVAREDLKRLRKVYADGREEEIALPASDVLIYHLGASDATPGSTARVIVRPSG
TEPKIKCYYELVLPMADDIAMADAQLQGDALMTALVDGHQAGLPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory