Comparing 6937022 FitnessBrowser__SB2B:6937022 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2df8A Crystal structure of the ph0510 protein from pyrococcus horikoshii ot3 in complex with beta-d-fructopyranose-1-phosphate
24% identity, 77% coverage: 63:369/397 of query aligns to 28:316/325 of 2df8A
Sites not aligning to the query:
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
25% identity, 63% coverage: 120:369/397 of query aligns to 339:598/608 of 4amvA
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
25% identity, 63% coverage: 120:369/397 of query aligns to 339:598/608 of 1jxaA
Sites not aligning to the query:
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
25% identity, 63% coverage: 120:369/397 of query aligns to 339:598/608 of 2j6hA
Sites not aligning to the query:
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
25% identity, 63% coverage: 120:369/397 of query aligns to 97:356/366 of 1morA
Sites not aligning to the query:
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
25% identity, 63% coverage: 120:369/397 of query aligns to 97:356/366 of 1moqA
Sites not aligning to the query:
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
25% identity, 63% coverage: 120:369/397 of query aligns to 97:356/357 of 7dnrA
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
25% identity, 63% coverage: 120:369/397 of query aligns to 98:357/367 of 1mosA
Sites not aligning to the query:
>6937022 FitnessBrowser__SB2B:6937022
MQVNDLSKTKICLEFGEDALRQPPKGSQWTAEEICQQPRLWREMAEQFVQEKSRLQDFAA
PLLALPDLRVILTGAGTSAYIGEALAPFLATQMPLVGQTVEAIATTDLVSHPHLYLHPAR
PTLVISFGRSGSSPESMAAIELCDALLPRCYHLLLTCNPQGSMARYGEQQAQRACLWLMP
EGSHDRSFAMTSSFSCMYLGVLLLFAANYSALARAVTLAERMLCDRVDEIAKLAALPLSR
VVFLGGGTLQGIAREAALKLLELSAGAVMGVHESPLGFRHGPKSLIDKDSLVVVLCSSEP
YARAYDMDMAAELERDGAASALVRLCEENVGADAQTLLEDVWLTFPYILYCQLFAYFKAL
NLGISADNPCPGGQVNRVVQGVKIYPLNQYRLPGVGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory