Comparing 6937023 FitnessBrowser__SB2B:6937023 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
39% identity, 92% coverage: 1:308/335 of query aligns to 5:305/306 of 7p7wBBB
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
39% identity, 92% coverage: 1:308/335 of query aligns to 2:302/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
39% identity, 92% coverage: 1:308/335 of query aligns to 3:303/304 of 7p9pAAA
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
41% identity, 92% coverage: 1:307/335 of query aligns to 1:299/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
41% identity, 92% coverage: 1:307/335 of query aligns to 3:301/305 of 2ap1A
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
34% identity, 92% coverage: 1:307/335 of query aligns to 9:307/311 of 4db3A
2qm1B Crystal structure of glucokinase from enterococcus faecalis
27% identity, 93% coverage: 4:314/335 of query aligns to 10:325/325 of 2qm1B
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
30% identity, 92% coverage: 1:309/335 of query aligns to 2:310/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
30% identity, 92% coverage: 1:309/335 of query aligns to 2:310/312 of 3vgkB
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
25% identity, 91% coverage: 5:309/335 of query aligns to 6:286/290 of 6jdbA
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
28% identity, 91% coverage: 4:308/335 of query aligns to 10:296/309 of P32718
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
26% identity, 81% coverage: 5:274/335 of query aligns to 6:261/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
26% identity, 81% coverage: 5:274/335 of query aligns to 6:261/293 of 6jdhA
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
31% identity, 90% coverage: 4:306/335 of query aligns to 5:289/298 of 3vovB
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
26% identity, 73% coverage: 71:316/335 of query aligns to 138:389/396 of 1z05A
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
27% identity, 70% coverage: 72:307/335 of query aligns to 64:300/306 of 5f7rA
Sites not aligning to the query:
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
27% identity, 70% coverage: 72:307/335 of query aligns to 145:384/396 of 5f7qE
Sites not aligning to the query:
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
26% identity, 90% coverage: 5:305/335 of query aligns to 6:262/269 of 6jdcA
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
30% identity, 49% coverage: 5:169/335 of query aligns to 6:151/289 of 2gupA
Sites not aligning to the query:
P45425 N-acetylmannosamine kinase; ManNAc kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.60 from Escherichia coli (strain K12) (see paper)
28% identity, 77% coverage: 5:263/335 of query aligns to 6:243/291 of P45425
>6937023 FitnessBrowser__SB2B:6937023
MHYGLDIGGTKIALALFDDSMACVERWQIPTPVADYGQFLDEVCAQIERADELAQQHSGV
TVQPAEVSKGSVGIALPGVILSDGTVLSSNVPCLNGRTVAQELTVRLGRPVALGNDCRCF
ALSEVLLGAGVGFERVLGVILGTGLGGGVCISQKLILGAHCLAGEFGHIGLPASVIIKHQ
LPLFECGCGLTGCAETYVSGTGLGRLYQHFGGTADTYVWLADYRSGKAEAISTFDAYMDA
LGSVLAGQILSLDPDCLVFGGGISEVKEIIAALPDATARHLFASAKLPEFRVAEFGAASG
VRGAALLGKALSEDYLADALSVEMGPEELQRRLHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory