Comparing 6937024 FitnessBrowser__SB2B:6937024 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
40% identity, 76% coverage: 76:388/411 of query aligns to 51:361/378 of O32445
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
40% identity, 76% coverage: 76:388/411 of query aligns to 52:362/379 of 3iv8A
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
38% identity, 83% coverage: 43:384/411 of query aligns to 15:360/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 83% coverage: 43:384/411 of query aligns to 15:360/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
38% identity, 83% coverage: 43:384/411 of query aligns to 15:360/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
38% identity, 83% coverage: 43:384/411 of query aligns to 15:359/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
36% identity, 81% coverage: 51:384/411 of query aligns to 23:334/356 of 2p50B
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
35% identity, 79% coverage: 76:399/411 of query aligns to 58:384/385 of 6jkuA
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
30% identity, 86% coverage: 49:403/411 of query aligns to 20:360/363 of 1o12A
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
34% identity, 80% coverage: 75:403/411 of query aligns to 57:396/401 of 7nutA
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
30% identity, 86% coverage: 35:387/411 of query aligns to 12:370/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
30% identity, 86% coverage: 35:387/411 of query aligns to 13:371/396 of O34450
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
34% identity, 83% coverage: 43:384/411 of query aligns to 14:312/334 of 1yrrB
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
33% identity, 69% coverage: 76:360/411 of query aligns to 51:333/381 of 6fv4A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
33% identity, 69% coverage: 76:360/411 of query aligns to 51:333/385 of 6fv4B
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
35% identity, 66% coverage: 76:346/411 of query aligns to 49:308/350 of 6fv3D
>6937024 FitnessBrowser__SB2B:6937024
MADVGSNCLPENLNDCWLNPEFVLVGADDASEFGVTGNAIAALVPDVWLKISQGHIETIS
RRPDVDLPQYRLPGILAPALVDTQVNGGGGVLINHQPTAAGINTLTQTHGQYGTGALLPT
VISDNLAVMEQALDGAIAARQGGDAAVVGIHFEGPHLSLAKKGCHSPALIRPIGEAEMTL
YADAVAALGCCMVTLAPETVEPADIARLVALGVRVSLGHSNADVATVEASLAAGASGFTH
LFNGMSALQGREPGMVGAALACPEAYCGIILDGEHVHATSATLAWRLKGTRRLMLVTDAM
SPTGTREESFEFFGGKVHRDGMVLRDEQGSLAGSVLTMTAAVRQACAMLGVSAAEALWMA
TATPAAFLGLKDIGRLAPGNRADLLLLDDALYQLGRWQAGQLVAGQEPPLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory