Comparing 6937060 FitnessBrowser__SB2B:6937060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 95% coverage: 4:252/261 of query aligns to 2:245/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 95% coverage: 4:252/261 of query aligns to 2:245/250 of 7z18I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 95% coverage: 5:251/261 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 95% coverage: 4:252/261 of query aligns to 2:245/250 of 7z16I
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 95% coverage: 5:251/261 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 95% coverage: 5:251/261 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 95% coverage: 5:251/261 of query aligns to 2:242/344 of 3tuiC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 96% coverage: 3:253/261 of query aligns to 15:250/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 93% coverage: 4:247/261 of query aligns to 1:232/241 of 4u00A
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
31% identity, 95% coverage: 4:251/261 of query aligns to 2:259/330 of P0AAH4
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 90% coverage: 20:253/261 of query aligns to 7:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 90% coverage: 20:253/261 of query aligns to 7:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 90% coverage: 20:253/261 of query aligns to 7:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 90% coverage: 20:253/261 of query aligns to 7:240/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 87% coverage: 28:253/261 of query aligns to 15:238/240 of 4ymuJ
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 86% coverage: 34:258/261 of query aligns to 46:270/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 86% coverage: 34:258/261 of query aligns to 46:270/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 82% coverage: 34:246/261 of query aligns to 46:258/260 of 7ahdC
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 80% coverage: 22:229/261 of query aligns to 7:215/276 of Q5M243
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 89% coverage: 22:253/261 of query aligns to 13:243/353 of 1oxvD
>6937060 FitnessBrowser__SB2B:6937060
MTTPLLKVTSLSKRYFTGYHRFKRQYNEALAPISFELGRGETLAIVGEAGSGKSTLARIL
VGAEQRSSGDIQFEGESLESRNLKQRCRLIRMIFQDPNTSLNPRLSIGELLEEPLRFNTG
MSAHERSVQVTETLRKVGLLPEHADFYPHMISEGQKQRVAVARALMLSPKVIIADEALTA
LDLSVRSQILNLLLHLQKEMGLSYIFVSHNLNLVRHVSDKIMVLHKGQLIEKGPVQKVFE
SPEHEYTARLIAEQTRQVRKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory