Comparing 6937119 FitnessBrowser__SB2B:6937119 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
64% identity, 100% coverage: 1:267/267 of query aligns to 1:267/267 of P0ADG4
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
64% identity, 100% coverage: 1:266/267 of query aligns to 5:270/270 of 6ib8B
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
63% identity, 98% coverage: 1:262/267 of query aligns to 1:262/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
61% identity, 99% coverage: 1:263/267 of query aligns to 1:255/255 of 6tqoT
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
45% identity, 96% coverage: 4:258/267 of query aligns to 3:255/258 of 3lv0A
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
44% identity, 96% coverage: 4:258/267 of query aligns to 3:237/238 of 3luzA
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
42% identity, 96% coverage: 4:258/267 of query aligns to 5:233/234 of 3luzB
2p3nA Thermotoga maritima impase tm1415 (see paper)
37% identity, 90% coverage: 5:243/267 of query aligns to 4:232/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
37% identity, 90% coverage: 5:243/267 of query aligns to 4:232/256 of O33832
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 94% coverage: 16:266/267 of query aligns to 22:267/271 of Q9M8S8
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
33% identity, 96% coverage: 8:262/267 of query aligns to 23:281/288 of O14732
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
34% identity, 90% coverage: 8:248/267 of query aligns to 10:254/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
34% identity, 90% coverage: 8:248/267 of query aligns to 12:256/277 of P20456
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
33% identity, 90% coverage: 8:246/267 of query aligns to 8:250/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
33% identity, 90% coverage: 8:246/267 of query aligns to 8:250/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
33% identity, 90% coverage: 8:246/267 of query aligns to 8:250/272 of 1awbA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
33% identity, 90% coverage: 8:246/267 of query aligns to 8:250/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
33% identity, 90% coverage: 8:246/267 of query aligns to 9:251/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
33% identity, 90% coverage: 8:246/267 of query aligns to 10:252/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
33% identity, 90% coverage: 8:246/267 of query aligns to 10:252/275 of 6giuA
>6937119 FitnessBrowser__SB2B:6937119
MHPMLTIAVRAARAAGQTIMRAYTDLDRVEVSTKGINDFVTSVDKEAEAAIVYQIRKSYP
DHTIVGEEQGENRGTNKDYIWIVDPLDGTTNFMRGIPHFAVSIALQYKGKTEVAVVYDPV
RDELFSAVRGQGAKVNDFRVRVSNVQDLNGTIIATGFPFKSRQHTQTYMNVLNEVFAQCA
DLRRAGAASLDLAYVAAGRMDGYFELGLKPWDIAAGDLIVREAGGTVTDFTGGHNYLMSG
NIVAGSPKATTALVKTMRPLLNEALKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory