SitesBLAST
Comparing 6937149 FitnessBrowser__SB2B:6937149 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
45% identity, 92% coverage: 14:416/437 of query aligns to 15:423/425 of O59010
- S65 (= S70) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A274) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 274:276) binding
- M311 (= M310) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T313) binding
- V355 (= V354) binding
- D394 (= D387) binding
- M395 (= M388) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R390) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N394) binding
- D405 (= D398) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
45% identity, 91% coverage: 14:410/437 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
45% identity, 91% coverage: 14:409/437 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S276), M303 (= M310), T306 (= T313), A345 (= A352), G346 (= G353), V347 (= V354), G351 (= G358), D386 (= D387), C389 (≠ R390), T390 (= T391), N393 (= N394)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
44% identity, 91% coverage: 14:412/437 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ I51), F46 (≠ I51), P75 (= P81), L91 (≠ F97), F95 (≠ I101), L130 (= L135), I133 (≠ V138), I159 (≠ V164), Y167 (≠ H172), K196 (≠ R193), G200 (≠ L197), I207 (≠ Y204), F210 (= F207), L250 (= L247), I262 (= I260), M269 (≠ Q267), T334 (= T333), V335 (≠ I334), G336 (≠ T335), T340 (≠ M339), L343 (≠ M342), M399 (≠ A392)
- binding aspartic acid: S277 (= S275), S278 (= S276), T314 (= T313), G354 (= G353), A358 (≠ V357), G359 (= G358), D394 (= D387), R397 (= R390), T398 (= T391)
- binding sodium ion: Y89 (= Y95), T92 (= T98), S93 (≠ T99), G306 (= G305), T308 (= T307), N310 (= N309), N310 (= N309), M311 (= M310), D312 (= D311), S349 (= S348), I350 (= I349), T352 (= T351), N401 (= N394), V402 (= V395), D405 (= D398)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
45% identity, 91% coverage: 14:409/437 of query aligns to 6:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
44% identity, 91% coverage: 14:409/437 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G74), V83 (≠ L92), I157 (= I165), Y164 (≠ H172), K193 (≠ R193), T305 (= T307), I306 (= I308), I347 (= I349)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I15), M199 (= M199), S275 (= S276), T311 (= T313), G356 (= G358), L384 (= L380), D391 (= D387), R394 (= R390)
Sites not aligning to the query:
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
44% identity, 92% coverage: 14:415/437 of query aligns to 10:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R193), G195 (≠ L197), R282 (≠ E285)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A274), S272 (= S275), S273 (= S276), M307 (= M310), T310 (= T313), G353 (= G356), A354 (≠ V357), R394 (= R390), T395 (= T391)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
44% identity, 92% coverage: 14:415/437 of query aligns to 11:420/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
44% identity, 92% coverage: 14:415/437 of query aligns to 13:422/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
44% identity, 92% coverage: 14:415/437 of query aligns to 13:422/427 of 5e9sA
- binding aspartic acid: R274 (≠ A274), S275 (= S275), S276 (= S276), T313 (= T313), G353 (= G353), V354 (= V354), A357 (≠ V357), G358 (= G358), D394 (= D387), R397 (= R390), T398 (= T391)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R193), G198 (≠ L197), Y202 (≠ L201)
- binding sodium ion: Y87 (= Y95), T90 (= T98), S91 (≠ T99), S276 (= S276), G305 (= G305), A306 (= A306), T307 (= T307), N309 (= N309), N309 (= N309), M310 (= M310), D311 (= D311), S348 (= S348), I349 (= I349), G350 (= G350), T351 (= T351), N401 (= N394), V402 (= V395), D405 (= D398)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
44% identity, 92% coverage: 14:415/437 of query aligns to 6:411/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A274), S265 (= S276), M299 (= M310), T302 (= T313), T340 (= T351), G342 (= G353), V343 (= V354), G347 (= G358), D383 (= D387), R386 (= R390), T387 (= T391), N390 (= N394)
- binding decyl-beta-d-maltopyranoside: H23 (≠ F32), V212 (≠ L222), A216 (≠ I226)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
42% identity, 91% coverage: 14:409/437 of query aligns to 7:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
37% identity, 86% coverage: 22:398/437 of query aligns to 33:391/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ K83), G89 (= G85), G92 (= G88), A95 (≠ T91), V96 (≠ L92), Y99 (= Y95), M163 (≠ V164), F167 (= F168), F293 (= F300), V297 (≠ L304)
- binding aspartic acid: S268 (= S275), S269 (= S276), T306 (= T313), G346 (= G353), I347 (≠ V354), A350 (≠ V357), G351 (= G358), D380 (= D387), R383 (= R390), T384 (= T391)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
34% identity, 83% coverage: 52:413/437 of query aligns to 56:465/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ E153) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
37% identity, 86% coverage: 22:398/437 of query aligns to 25:377/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ T75), S80 (≠ K83), G81 (= G85), G84 (= G88), Y91 (= Y95), M156 (≠ V164), F160 (= F168), F286 (= F300), V290 (≠ L304)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V67), I148 (≠ M156), S262 (= S276), S263 (≠ N277), A292 (= A306), T293 (= T307), M296 (= M310), T299 (= T313), G329 (= G350), A336 (≠ V357), G337 (= G358), D366 (= D387), R369 (= R390), N373 (= N394)
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
32% identity, 88% coverage: 52:435/437 of query aligns to 82:528/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
33% identity, 87% coverage: 22:400/437 of query aligns to 61:489/542 of P43003
- S363 (≠ A274) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 274:276) binding
- T396 (= T307) binding
- T402 (= T313) binding
- IPQAG 443:447 (≠ VPGVG 354:358) binding
- D476 (= D387) binding
- R477 (≠ M388) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N394) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
33% identity, 87% coverage: 22:400/437 of query aligns to 61:489/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
32% identity, 88% coverage: 52:435/437 of query aligns to 82:529/573 of P31596
- K298 (= K212) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (= H239) mutation H->N,T,K,R: No transporter activity.
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
34% identity, 82% coverage: 52:409/437 of query aligns to 47:417/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S275), S281 (= S276), T318 (= T313), G363 (= G358), M367 (≠ L362), V385 (≠ L380), D388 (= D383), R395 (= R390), T396 (= T391)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R384)
- binding cholesterol hemisuccinate: R80 (= R86), R84 (≠ K90), I95 (= I101), I252 (≠ L247)
Sites not aligning to the query:
Query Sequence
>6937149 FitnessBrowser__SB2B:6937149
MAAAQSSKIGLTGKILIGMGAGILIGLLLRNFFGGSEWVQDYITEGFFHVIGTIFINSLK
MLVVPLVFISLVCGTCSLSEPSKLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPGNASL
ASESMQYSAKEAPSLADVLINIVPSNPMKALSEGNMLQIIIFAVIFGFAISHIGERGRRV
AALFDDLNEVIMRVVTLIMQLAPYGVFALMGKLALTLGMETLESVIKYFMLVLVVLLFHG
FVVYPTLLKLFSGLSPLMFIRKMRDVQLFAFSTASSNATLPVTMEASEHRLGADNKVASF
TLPLGATINMDGTAIMQGVATVFIAQVFGIDLTITDYAMVVMTATLASIGTAGVPGVGLV
MLAMVLNQVGLPVEGIALILGVDRMLDMVRTAVNVTGDTVATVVIAKSEGALNEAVFNDP
KAGKTAGSFDAEVHRGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory