Comparing 6937163 FitnessBrowser__SB2B:6937163 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
60% identity, 98% coverage: 1:224/229 of query aligns to 1:224/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
60% identity, 97% coverage: 4:224/229 of query aligns to 1:221/222 of 7arlD
7mdyC Lolcde nucleotide-bound
60% identity, 97% coverage: 4:224/229 of query aligns to 1:221/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
60% identity, 97% coverage: 4:224/229 of query aligns to 3:223/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
49% identity, 96% coverage: 5:224/229 of query aligns to 3:217/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 96% coverage: 5:224/229 of query aligns to 4:222/648 of P75831
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
44% identity, 98% coverage: 5:229/229 of query aligns to 3:226/226 of 5xu1B
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
46% identity, 96% coverage: 5:223/229 of query aligns to 4:221/650 of 5ws4A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
39% identity, 98% coverage: 5:229/229 of query aligns to 3:226/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
39% identity, 98% coverage: 5:229/229 of query aligns to 3:226/592 of 5lj7A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
41% identity, 96% coverage: 5:223/229 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 96% coverage: 5:223/229 of query aligns to 1:223/230 of 1l2tA
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
40% identity, 96% coverage: 5:223/229 of query aligns to 1:215/222 of 8i6rB
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
39% identity, 97% coverage: 5:227/229 of query aligns to 1:219/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
39% identity, 97% coverage: 5:226/229 of query aligns to 1:218/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
39% identity, 97% coverage: 5:226/229 of query aligns to 1:218/218 of 8hd0A
8g4cB Bceabs atpgs high res tm (see paper)
32% identity, 97% coverage: 4:225/229 of query aligns to 2:223/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
32% identity, 97% coverage: 4:225/229 of query aligns to 1:222/245 of 7tchB
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 93% coverage: 6:218/229 of query aligns to 4:215/330 of P9WQK5
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 95% coverage: 8:224/229 of query aligns to 6:220/353 of 1oxvD
>6937163 FitnessBrowser__SB2B:6937163
MQDILLKVENVSKTYREGKLETQVLCGVDLSVYRGEQLAIVGGSGSGKSTLLHIMGSLDK
PTSGKVLLEGEDLYSLSAARQAQIRNASLGFIYQFHHLLPEFSALENVAMPARIAGVDKK
TAFGRAEALLERVGLSHRLSHAPSELSGGERQRVAIARALINQPRLVLADEPTGNLDAAS
GEAVYALIRELAAQLGTAFVVVTHDNALAARMDRQLSMKSGKLTTGARQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory