SitesBLAST
Comparing 6937188 FitnessBrowser__SB2B:6937188 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
61% identity, 99% coverage: 3:294/296 of query aligns to 29:321/325 of P35914
- E37 (= E11) to K: in HMGCLD; activity lower than 5% respect to the wild-type; mutation to D: Normal activity.
- R41 (= R15) to Q: in HMGCLD; loss of activity and of proton exchange; dbSNP:rs121964997; mutation to M: Reduced activity, and loss of proton exchange.
- D42 (= D16) to E: in HMGCLD; reduced activity; to G: in HMGCLD; loss of activity; dbSNP:rs1467902610; to H: in HMGCLD; loss of activity; mutation D->A,N: Loss of activity, and reduced proton exchange rate.
- K48 (= K22) to N: in HMGCLD; abolishes almost all enzymatic activity
- E72 (= E45) mutation to A: Loss of activity, and reduced affinity for metal cofactor and substrate.
- S142 (= S115) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- C174 (= C147) to Y: in HMGCLD; activity lower than 5% respect to the wild-type; dbSNP:rs765475941
- F192 (≠ L165) to S: in HMGCLD; activity lower than 5% respect to the wild-type
- I200 (= I173) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- G203 (= G176) to E: in HMGCLD; complete loss of activity; dbSNP:rs1553131940
- D204 (= D177) mutation to A: Reduced activity, and reduced affinity for metal cofactor and substrate.
- H233 (= H206) to R: in HMGCLD; loss of activity; dbSNP:rs727503963; mutation to A: Loss of activity, and reduced proton exchange rate.
- E279 (= E252) mutation to A: Reduced thermal stability, but normal activity.
- D280 (= D253) mutation to A: Normal activity.
Sites not aligning to the query:
- 323 modified: Interchain; C→S: Abolishes interchain homodimerization. Exhibits no DTT stimulated activity.
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
61% identity, 99% coverage: 3:294/296 of query aligns to 2:294/296 of 3mp3B
- binding (3R,5S,9R,21S)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,21-tetrahydroxy-8,8-dimethyl-10,14,19-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphatricosan-23-oic acid 3,5-dioxide: R14 (= R15), D15 (= D16), Q18 (= Q19), F49 (= F49), V50 (= V50), S51 (= S51), W54 (= W54), P81 (= P81), N82 (= N82), K84 (= K84), G85 (= G85), N111 (= N111), R122 (= R122), Y140 (= Y140), S142 (= S142), T178 (= T178), H206 (= H206)
- binding magnesium ion: D15 (= D16), H206 (= H206), H208 (= H208)
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
61% identity, 99% coverage: 3:294/296 of query aligns to 2:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
61% identity, 99% coverage: 3:294/296 of query aligns to 2:294/296 of 3mp5B
- binding 3-hydroxy-3-methylglutaryl-coenzyme a: D15 (= D16), Q18 (= Q19), S51 (= S51), W54 (= W54), F100 (= F100), N111 (= N111), N113 (= N113), Y140 (= Y140), S142 (= S142), T178 (= T178), C239 (= C239)
- binding magnesium ion: D15 (= D16), H206 (= H206), H208 (= H208)
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
57% identity, 99% coverage: 3:294/296 of query aligns to 74:366/370 of Q8TB92
- R86 (= R15) mutation to Q: Abolishes catalytic activity.
- L237 (= L165) mutation to S: Abolishes catalytic activity.
- H278 (= H206) mutation to R: Abolishes catalytic activity.
Sites not aligning to the query:
- 2 modified: N-myristoyl glycine; G→A: Abolishes myristoylation and induces a subcellular location change.
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
57% identity, 98% coverage: 7:295/296 of query aligns to 4:293/301 of P13703
- C237 (= C239) active site
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
58% identity, 92% coverage: 6:276/296 of query aligns to 3:274/283 of 1ydnA
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
41% identity, 96% coverage: 11:294/296 of query aligns to 12:295/305 of 6ndsA
- binding coenzyme a: V52 (= V50), S53 (= S51), I57 (≠ V55), N84 (= N82), G87 (= G85), R90 (≠ L88), N113 (= N111), M114 (≠ I112), R115 (≠ N113)
- binding zinc ion: D17 (= D16), H207 (= H206), H209 (= H208)
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 75% coverage: 15:237/296 of query aligns to 30:247/399 of 6ktqA
- binding 2-oxoglutaric acid: R30 (= R15), R154 (= R138), T156 (≠ Y140), E158 (≠ S142), S184 (= S174), T188 (= T178), H216 (= H206), H218 (= H208)
- binding coenzyme a: V67 (≠ D60), R96 (vs. gap), A97 (vs. gap), F116 (= F100), H128 (≠ I112), E158 (≠ S142)
- binding zinc ion: E31 (≠ D16), H216 (= H206), H218 (= H208)
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
37% identity, 38% coverage: 161:272/296 of query aligns to 162:266/453 of 2nx9B
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
26% identity, 93% coverage: 9:284/296 of query aligns to 6:277/308 of 3rmjB
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 96% coverage: 1:284/296 of query aligns to 1:280/517 of Q9JZG1
- D16 (= D16) binding
- H204 (= H206) binding
- H206 (= H208) binding
- N240 (= N248) binding
Sites not aligning to the query:
- 366:517 Required for the condensation reaction. Not required to bind substrate
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 65% coverage: 92:284/296 of query aligns to 180:370/506 of Q9FG67
- A290 (= A204) mutation to T: In gsm1-2; loss of conversion of C3 to C4 glucosinolates.
Sites not aligning to the query:
- 102 S→F: In gsm1-1; loss of conversion of C3 to C4 glucosinolates.
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
28% identity, 75% coverage: 15:237/296 of query aligns to 12:220/314 of 2zyfA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
27% identity, 75% coverage: 15:237/296 of query aligns to 12:226/376 of O87198
- R12 (= R15) binding
- E13 (≠ D16) binding
- H72 (≠ A78) binding ; mutation to L: Significant decrease in sensitivity to lysine inhibition. Large decrease in affinity for 2-oxoglutarate. Almost no effect on affinity for acetyl-CoA and on turnover number.
- D92 (≠ A98) binding
- R133 (≠ I153) binding
- S135 (≠ T155) binding
- T166 (= T178) binding ; binding
- H195 (= H206) binding
- H197 (= H208) binding
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
34% identity, 24% coverage: 167:237/296 of query aligns to 152:221/370 of 3mi3A
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
34% identity, 24% coverage: 167:237/296 of query aligns to 181:250/400 of 3ivtB
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
34% identity, 24% coverage: 167:237/296 of query aligns to 150:219/364 of 3ivsA
Sites not aligning to the query:
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
34% identity, 24% coverage: 167:237/296 of query aligns to 186:255/418 of Q9Y823
- T197 (= T178) binding ; binding ; mutation to A: Exhibits a 25-fold decrease in catalytic efficiency.; mutation to S: Results in a modest decrease in catalytic efficiency.; mutation to V: Abolishes the catalytic activity.
- E222 (≠ A204) mutation to Q: Does not affect the catalytic activity but impairs L-lysine inhibition.
- H224 (= H206) binding ; binding
- H226 (= H208) binding ; binding
Sites not aligning to the query:
- 43 binding ; mutation R->A,K,Q: Abolishes the catalytic activity.
- 44 binding ; binding ; binding
- 47 Q→A: Abolishes the catalytic activity.
- 74 E→A: Abolishes the catalytic activity.; E→Q: Results in a moderate decrease in the turnover number and a slight increase in the Km value for each substrate.
- 103 binding ; H→A: Substantially impairs catalytic efficiency.
- 123 binding ; D→N: Does not affect the catalytic activity but impairs L-lysine inhibition.
- 163 binding ; mutation R->A,Q: Abolishes the catalytic activity.; R→K: Severely diminishes affinity for 2-oxoglutarate and substantially impairs catalytic efficiency.
- 165 binding ; S→A: Results in a moderate decrease in catalytic efficiency.
- 167 mutation E->A,Q: Abolishes the catalytic activity.
- 288 R→K: Does not affect the catalytic activity but impairs L-lysine inhibition.
- 332 Y→A: Abolishes the catalytic activity.; Y→F: Results in a decrease in catalytic efficiency.
- 364 Q→R: Does not affect the catalytic activity but impairs L-lysine inhibition.
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
28% identity, 75% coverage: 15:237/296 of query aligns to 11:219/347 of 3a9iA
Query Sequence
>6937188 FitnessBrowser__SB2B:6937188
MALPTHISLFEVGPRDGLQNEKQVTTADKILLVESLAAAGVKRIEAASFVSPKWVPQMAD
SGEVLKGISRVAGVRYSALTPNLKGLELALDANASEVAVFAAASEGFSQKNINCSIEESI
ERFIPLIEKAKEHNLPVRGYVSCVLGCPYDGEIATSEVARVSEILYKLGCYEISLGDTIG
VGTPLKARKMVEAVAARVPVDKLALHFHDTYGQALANILASLESGIRTVDTSVAGLGGCP
YAKGASGNLASEDLVYMLHGMGIETGIDLHKLIEAGNRISAALGRHSGAKVARALT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory