SitesBLAST
Comparing 6937211 FitnessBrowser__SB2B:6937211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
43% identity, 99% coverage: 3:252/252 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G16), N111 (= N121), S139 (= S149), Q149 (= Q159), Y152 (= Y162), K156 (= K166)
- binding acetoacetyl-coenzyme a: D93 (= D94), K98 (≠ R108), S139 (= S149), N146 (= N156), V147 (≠ M157), Q149 (= Q159), Y152 (= Y162), F184 (≠ V194), M189 (= M199), K200 (≠ R210)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ G15), G18 (= G16), I19 (≠ L17), D38 (= D36), F39 (≠ V37), V59 (≠ L60), D60 (= D61), V61 (≠ I62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (= I91), T137 (≠ N147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), F184 (≠ V194), T185 (≠ I195), T187 (= T197), M189 (= M199)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
40% identity, 97% coverage: 6:250/252 of query aligns to 2:249/253 of 4nbwA
- active site: G12 (= G16), S146 (= S149), Y159 (= Y162), K163 (= K166)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), N11 (≠ G15), G12 (= G16), I13 (≠ L17), D32 (= D36), L33 (≠ V37), V57 (≠ L60), D58 (= D61), V59 (≠ I62), N85 (= N88), A86 (= A89), G87 (= G90), S146 (= S149), Y159 (= Y162), K163 (= K166), I192 (= I195), T194 (= T197)
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
38% identity, 98% coverage: 5:252/252 of query aligns to 6:239/241 of 4cqmF
- active site: G17 (= G16), S139 (= S150), Q149 (= Q159), Y152 (= Y162), K156 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (≠ G15), G17 (= G16), I18 (≠ L17), A37 (≠ D36), R38 (≠ V37), N39 (≠ D38), D60 (= D61), V61 (≠ I62), A87 (≠ N88), A88 (= A89), G89 (= G90), V137 (≠ I148), S139 (= S150), Y152 (= Y162), K156 (= K166), V185 (≠ I195), T187 (= T197), M189 (= M199)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
38% identity, 98% coverage: 5:252/252 of query aligns to 2:235/237 of Q8N4T8
- G9 (= G12) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (≠ AGGL 14:17) binding
- R12 (≠ G15) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (≠ V37) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (≠ VD 37:38) binding
- D56 (= D61) binding
- L70 (≠ I75) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ NAG 88:90) binding
- S135 (= S150) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y162) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K166) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (= R182) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (≠ F183) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ IAT 195:197) binding
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
38% identity, 100% coverage: 2:252/252 of query aligns to 2:239/239 of 4nbtA
- active site: G16 (= G16), S132 (= S150), Y145 (= Y162), K149 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (≠ G15), G16 (= G16), L17 (= L17), D36 (= D48), L37 (≠ I49), L52 (= L60), N53 (≠ D61), V54 (≠ I62), N80 (= N88), A81 (= A89), G82 (= G90), I130 (= I148), S132 (= S150), Y145 (= Y162), K149 (= K166), P177 (= P192), G178 (= G193), I180 (= I195), T182 (= T197)
P73826 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
39% identity, 98% coverage: 3:248/252 of query aligns to 6:236/240 of P73826
- S134 (= S150) mutation to A: 12% enzymatic activity.
- Y147 (= Y162) mutation to A: No enzymatic activity.
- K151 (= K166) mutation to A: 5% enzymatic activity.
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
40% identity, 99% coverage: 1:250/252 of query aligns to 1:237/240 of 4dmmB
- active site: G16 (= G16), S142 (= S150), Q152 (= Q159), Y155 (= Y162), K159 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (≠ G15), G16 (= G16), I17 (≠ L17), A37 (≠ V37), S38 (≠ D38), S39 (≠ Q39), A62 (≠ L60), D63 (= D61), V64 (≠ I62), N90 (= N88), A91 (= A89), L113 (≠ V120), I140 (= I148), S142 (= S150), Y155 (= Y162), K159 (= K166), P185 (= P192), G186 (= G193), I188 (= I195), T190 (= T197), M192 (= M199)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 99% coverage: 1:250/252 of query aligns to 1:245/247 of 4jroC
- active site: G16 (= G16), S142 (= S149), Q152 (= Q159), Y155 (= Y162), K159 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (≠ G15), G16 (= G16), I17 (≠ L17), N35 (vs. gap), Y36 (≠ I35), N37 (≠ D36), G38 (≠ V37), S39 (≠ D38), N63 (≠ D61), V64 (≠ I62), N90 (= N88), A91 (= A89), I93 (= I91), I113 (≠ V120), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (= I195), T190 (= T197)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
36% identity, 98% coverage: 5:252/252 of query aligns to 1:244/244 of 1edoA
- active site: G12 (= G16), S138 (= S149), Y151 (= Y162), K155 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ A14), R11 (≠ G15), I13 (≠ L17), N31 (≠ D38), Y32 (≠ Q39), A33 (≠ E40), R34 (= R41), S35 (≠ L42), D59 (= D61), V60 (≠ I62), N86 (= N88), A87 (= A89), S138 (= S149), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193), I184 (= I195), S186 (≠ T197), M188 (= M199)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 100% coverage: 1:252/252 of query aligns to 4:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (≠ G15), G19 (= G16), I20 (≠ L17), D39 (= D36), R40 (≠ V37), C63 (≠ L60), I65 (= I62), N91 (= N88), G93 (= G90), I94 (= I91), V114 (= V120), Y155 (= Y162), K159 (= K166), I188 (= I195), T190 (= T197), T193 (= T200)
1e3wD Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate (see paper)
38% identity, 100% coverage: 2:252/252 of query aligns to 1:253/255 of 1e3wD
- active site: G15 (= G16), N115 (= N121), T147 (≠ I148), S149 (= S150), Y162 (= Y162), K166 (= K166), F195 (≠ I195)
- binding acetoacetic acid: Y162 (= Y162), T202 (≠ A202)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (≠ G15), G15 (= G16), L16 (= L17), D35 (= D36), V36 (= V37), N58 (≠ D61), V59 (≠ I62), C85 (≠ N88), A86 (= A89), G87 (= G90), V114 (= V120), T147 (≠ I148), Y162 (= Y162), K166 (= K166), P192 (= P192), L194 (≠ V194), F195 (≠ I195), T197 (= T197), L199 (≠ M199)
O70351 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Rattus norvegicus (Rat) (see paper)
38% identity, 100% coverage: 2:252/252 of query aligns to 7:259/261 of O70351
- S155 (= S150) binding
- Y168 (= Y162) active site, Proton acceptor
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
38% identity, 98% coverage: 3:250/252 of query aligns to 4:244/247 of P73574
- A14 (≠ G13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ M157) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K166) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ V194) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ K204) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
34% identity, 99% coverage: 2:250/252 of query aligns to 3:246/248 of 4cqmA
- active site: G17 (= G16), S143 (= S150), Y156 (= Y162), K160 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S16 (≠ G15), G17 (= G16), I18 (≠ L17), D37 (= D36), L38 (≠ V37), A61 (≠ L60), V63 (≠ I62), C90 (≠ N88), A91 (= A89), G92 (= G90), I93 (= I91), V113 (= V120), I141 (= I148), S143 (= S150), Y156 (= Y162), K160 (= K166), P186 (= P192), G187 (= G193), I189 (= I195), T191 (= T197), P192 (≠ E198), M193 (= M199), T194 (= T200)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
35% identity, 98% coverage: 3:250/252 of query aligns to 6:249/251 of 4cqlI
- active site: G19 (= G16), S146 (= S150), Y159 (= Y162), K163 (= K166)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ G15), G19 (= G16), I20 (≠ L17), D39 (= D36), L40 (≠ V37), A64 (≠ L60), D65 (= D61), V66 (≠ I62), C93 (≠ N88), A94 (= A89), G95 (= G90), I96 (= I91), V116 (= V120), I144 (= I148), S146 (= S150), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (= G193), I192 (= I195), T194 (= T197), M196 (= M199)
O18404 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxyacyl-CoA dehydrogenase type II; Hydroxysteroid dehydrogenase; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.62; EC 1.1.1.-; EC 1.1.1.53 from Drosophila melanogaster (Fruit fly) (see paper)
37% identity, 99% coverage: 3:252/252 of query aligns to 2:253/255 of O18404
- L33 (= L34) mutation to Q: Lethal allele.
- F120 (= F126) mutation to I: Lethal allele.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 100% coverage: 1:252/252 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ A14), R18 (≠ G15), I20 (≠ L17), T40 (≠ D38), N62 (≠ D61), V63 (≠ I62), N89 (= N88), A90 (= A89), I92 (= I91), V139 (≠ N147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), I187 (= I195), T189 (= T197), M191 (= M199)
Q92506 (3R)-3-hydroxyacyl-CoA dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 8; 17-beta-HSD 8; HSD17B8; 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit; KAR alpha subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; Estradiol 17-beta-dehydrogenase 8; Protein Ke6; Ke6; Short chain dehydrogenase/reductase family 30C member 1; Testosterone 17-beta-dehydrogenase 8; EC 1.1.1.n12; EC 1.1.1.62; EC 1.1.1.239 from Homo sapiens (Human) (see 2 papers)
34% identity, 98% coverage: 3:250/252 of query aligns to 9:259/261 of Q92506
- 15:23 (vs. 9:17, 33% identical) binding
- D42 (= D36) mutation to A: Reduced NADH-dependent reductase activity with acetoacetyl-CoA. Reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Increases NADPH-dependent reductase activities. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- DL 42:43 (≠ DV 36:37) binding
- ADV 74:76 (≠ LDI 60:62) binding
- R148 (≠ G142) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- V158 (vs. gap) to L: in a breast cancer sample; somatic mutation
- Y169 (= Y162) mutation to A: Strongly reduced NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- YAASK 169:173 (= YAASK 162:166) binding
- K173 (= K166) mutation to A: Abolishes NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Slightly decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- R189 (= R182) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- IAT 202:204 (= IAT 195:197) binding
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 98% coverage: 6:252/252 of query aligns to 5:246/246 of 3osuA
4o5oB X-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis
39% identity, 100% coverage: 1:252/252 of query aligns to 7:258/261 of 4o5oB
Sites not aligning to the query:
Query Sequence
>6937211 FitnessBrowser__SB2B:6937211
MELKDKVIVITGGAGGLGLAMAKDLAAHGAKLALIDVDQERLERACADIGDATEVQGYAL
DITDEEDVVAGFRYILEDFGVIHGLVNNAGILRDGLLIKAKDGVVTDRMSLDQFQSVINV
NLTGTFLCGREAAAAMIESGQGGVIVNISSLARAGNMGQTNYAASKAGVATMAVGWAKEL
ARFNIRAAAVAPGVIATEMTAAMKPEALERLEKMVPVGRLGQAEEIASTVRFIMENDYVN
GRVFEIDGGIRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory